(data stored in ACNUC7421 zone)

EMBL: CP000271.PE404

CP000271.PE404       Location/Qualifiers
FT   CDS             463955..464983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2621"
FT                   /product="xylose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2621"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33372"
FT                   /db_xref="GOA:Q13RB7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB7"
FT                   /protein_id="ABE33372.1"
FT                   /translation="MKFATRRSVLSSLVCGAVLASLSLAAPLAHASKDHPEIGFCIDDL
FT                   RVERWSRDRDYFVAAAEKLGAKVSVQSADASEERQISQIENLISRGVDVIVIVPFNSKT
FT                   LGNVVAEAKKAGIKVVSYDRLILDADVDAYISFDNEKVGELQAQGVYNAQPKGNYFLLG
FT                   GAPTDNNAKMLREGQLKILKPAMDKGDIKVVGQQWVPEWSASTALRIVEDALTANNNKI
FT                   DAIVASNDGTAGGAIQALAAQHLAGKVPVSGQDADLAAVKRVIAGTQTMTVYKPLKLIA
FT                   SEAAKLSVALAKGQKPGYNAQYDNGKKKVDTVLLQPTLLTKTNVDVVVKDGFYTQAQLA
FT                   SQ"
     MKFATRRSVL SSLVCGAVLA SLSLAAPLAH ASKDHPEIGF CIDDLRVERW SRDRDYFVAA        60
     AEKLGAKVSV QSADASEERQ ISQIENLISR GVDVIVIVPF NSKTLGNVVA EAKKAGIKVV       120
     SYDRLILDAD VDAYISFDNE KVGELQAQGV YNAQPKGNYF LLGGAPTDNN AKMLREGQLK       180
     ILKPAMDKGD IKVVGQQWVP EWSASTALRI VEDALTANNN KIDAIVASND GTAGGAIQAL       240
     AAQHLAGKVP VSGQDADLAA VKRVIAGTQT MTVYKPLKLI ASEAAKLSVA LAKGQKPGYN       300
     AQYDNGKKKV DTVLLQPTLL TKTNVDVVVK DGFYTQAQLA SQ                          342
//

If you have problems or comments...

PBIL Back to PBIL home page