(data stored in ACNUC7421 zone)

EMBL: CP000271.PE405

CP000271.PE405       Location/Qualifiers
FT   CDS             465063..466622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2620"
FT                   /product="xylose ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2620"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33373"
FT                   /db_xref="GOA:Q13RB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RB6"
FT                   /protein_id="ABE33373.1"
FT                   /translation="MTQPLMTMRGIVKTFSGVKALDGIDLTIAPGECVGLCGENGAGKS
FT                   TLMKVLSGVYPWGTWDGEIIWEGAPLKAASVRDTERAGIIIIHQELMLVPELSVAENIF
FT                   LGNEITLPGGRMNYAAMYQRADELLRELGISGINAAQPVMNYGGGHQQLIEIAKALNKR
FT                   AKLLILDEPSSSLTASEISILLDIVRDLKRRGVACVYISHKLDEVAAVCDTISVIRDGR
FT                   HVATEPMRALTTDRIISLMVGREIKNLFPREPHPIGDVIFEARHVTCFDVTNPRRKRVN
FT                   DVSFALRRGEILGVAGLVGAGRTELMQAIFGAYPGVSEATVVMEGKPLKIRAPVDAIRA
FT                   GIGMVPEDRKRHGIVPGLSVGHNITLAVLGRFASAGRIDSAAELDTIHTEMKRLSVRAA
FT                   HPMLSIASLSGGNQQKAVLTRMLLTNPKVLILDEPTRGVDVGAKYEIYKLIFQLAQRGM
FT                   SIVMVSSELPEVLGISDRVLVIGEGELRGDFVNDGLTQEDILSAAIRPVQRSPNPTVAS
FT                   AA"
     MTQPLMTMRG IVKTFSGVKA LDGIDLTIAP GECVGLCGEN GAGKSTLMKV LSGVYPWGTW        60
     DGEIIWEGAP LKAASVRDTE RAGIIIIHQE LMLVPELSVA ENIFLGNEIT LPGGRMNYAA       120
     MYQRADELLR ELGISGINAA QPVMNYGGGH QQLIEIAKAL NKRAKLLILD EPSSSLTASE       180
     ISILLDIVRD LKRRGVACVY ISHKLDEVAA VCDTISVIRD GRHVATEPMR ALTTDRIISL       240
     MVGREIKNLF PREPHPIGDV IFEARHVTCF DVTNPRRKRV NDVSFALRRG EILGVAGLVG       300
     AGRTELMQAI FGAYPGVSEA TVVMEGKPLK IRAPVDAIRA GIGMVPEDRK RHGIVPGLSV       360
     GHNITLAVLG RFASAGRIDS AAELDTIHTE MKRLSVRAAH PMLSIASLSG GNQQKAVLTR       420
     MLLTNPKVLI LDEPTRGVDV GAKYEIYKLI FQLAQRGMSI VMVSSELPEV LGISDRVLVI       480
     GEGELRGDFV NDGLTQEDIL SAAIRPVQRS PNPTVASAA                              519
//

If you have problems or comments...

PBIL Back to PBIL home page