(data stored in ACNUC7421 zone)

EMBL: CP000271.PE406

CP000271.PE406       Location/Qualifiers
FT   CDS             466619..467818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2619"
FT                   /product="xylose ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2619"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33374"
FT                   /db_xref="GOA:Q13RB5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB5"
FT                   /protein_id="ABE33374.1"
FT                   /translation="MTPDVTSQRADEALPRGAFGGPQRLQQLFARYKILALLIAVAAIW
FT                   IFFSVLTHGAFVTPRNLSNLLRQMSITGMLACGMVFVIIAGEIDLSVGSLLGLLGGVAA
FT                   ILDVNRHWPLAVTLPVVMLLGVLIGMFNGWWSTYRRVPSFIVGLGGMLAYRGILLGVTG
FT                   GSTIAPVSDGFVFVGQGYLPRLAGDTLAVVLFVLLAFLTIRQRRNRERYQLRVVPVWQD
FT                   VVKVVGAGVILAGFVATLDRYGGIPVPVLLLLALLGIFTWIATQTVFGRRIYAVGSNLE
FT                   ATRLSGVNTNRVKLAIFALMGLMCAFGGIVNTARLAAGSPSAGSMGELDAIAACFIGGT
FT                   SMRGGSGTVYGALIGALVMASLDNGMSMLDVDAYWQMIVKGSILVLAVWIDVVSGSNRR
FT                   "
     MTPDVTSQRA DEALPRGAFG GPQRLQQLFA RYKILALLIA VAAIWIFFSV LTHGAFVTPR        60
     NLSNLLRQMS ITGMLACGMV FVIIAGEIDL SVGSLLGLLG GVAAILDVNR HWPLAVTLPV       120
     VMLLGVLIGM FNGWWSTYRR VPSFIVGLGG MLAYRGILLG VTGGSTIAPV SDGFVFVGQG       180
     YLPRLAGDTL AVVLFVLLAF LTIRQRRNRE RYQLRVVPVW QDVVKVVGAG VILAGFVATL       240
     DRYGGIPVPV LLLLALLGIF TWIATQTVFG RRIYAVGSNL EATRLSGVNT NRVKLAIFAL       300
     MGLMCAFGGI VNTARLAAGS PSAGSMGELD AIAACFIGGT SMRGGSGTVY GALIGALVMA       360
     SLDNGMSMLD VDAYWQMIVK GSILVLAVWI DVVSGSNRR                              399
//

If you have problems or comments...

PBIL Back to PBIL home page