(data stored in ACNUC7421 zone)

EMBL: CP000271.PE407

CP000271.PE407       Location/Qualifiers
FT   CDS             complement(467845..469737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2618"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Tetratricopeptide repeat present"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2618"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33375"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB4"
FT                   /protein_id="ABE33375.1"
FT                   /translation="MHLRRSYAAQMHNFTHKRSWLSLKMPDATAHHSYVVDIDALIARA
FT                   DADYSALRMRDAESGYQRALALSPLNVHALHRMGLVCVHLKKIAEADTYLERALNADPA
FT                   RADLWEHAGLIAAIKGEYIRSEAFYRRALGLSGSTATLHRNLADCLRLSGRLADAKVQY
FT                   KKALSIEPDLHHAIRAIARLSAELGETDDAADYWLSAWALDSSSLQDGFDLIHALAKAN
FT                   RTVRVNEAVAQISKREADNPEALQALCLALYRVDSFANMLNVARQAIRMDPQRVALHHY
FT                   AAHALSVRGRVAEALVYSSEAVRLAPDDPVMQCQLACLELSQGDFKSGWARRNMTYAMP
FT                   LARATLVFPDFPVWNGEPVSGSSFLLVGEQGRGDEIQFIRFAEWLHQQGAVVDVLVSQP
FT                   VARIAASMTGVRSVFTKLPAGPYDYWSHMLRMPEHMKLDLPMLPVAMPYISASPLHVDQ
FT                   WRSRINAASPSTAYKKTARIGVVWAGGAHTALDRFRSISMEALKPLLEHPGTTWFSLQK
FT                   GEHERDSERLAGKFDLHTLGPVIEDFADTLAILETLDLLITVDTAVAHLAGAANLPVWV
FT                   LLPAYSELRWLTGRTDSPWYPSMRLFRQRELGEWNTVVEEMREALTDWCRTGPI"
     MHLRRSYAAQ MHNFTHKRSW LSLKMPDATA HHSYVVDIDA LIARADADYS ALRMRDAESG        60
     YQRALALSPL NVHALHRMGL VCVHLKKIAE ADTYLERALN ADPARADLWE HAGLIAAIKG       120
     EYIRSEAFYR RALGLSGSTA TLHRNLADCL RLSGRLADAK VQYKKALSIE PDLHHAIRAI       180
     ARLSAELGET DDAADYWLSA WALDSSSLQD GFDLIHALAK ANRTVRVNEA VAQISKREAD       240
     NPEALQALCL ALYRVDSFAN MLNVARQAIR MDPQRVALHH YAAHALSVRG RVAEALVYSS       300
     EAVRLAPDDP VMQCQLACLE LSQGDFKSGW ARRNMTYAMP LARATLVFPD FPVWNGEPVS       360
     GSSFLLVGEQ GRGDEIQFIR FAEWLHQQGA VVDVLVSQPV ARIAASMTGV RSVFTKLPAG       420
     PYDYWSHMLR MPEHMKLDLP MLPVAMPYIS ASPLHVDQWR SRINAASPST AYKKTARIGV       480
     VWAGGAHTAL DRFRSISMEA LKPLLEHPGT TWFSLQKGEH ERDSERLAGK FDLHTLGPVI       540
     EDFADTLAIL ETLDLLITVD TAVAHLAGAA NLPVWVLLPA YSELRWLTGR TDSPWYPSMR       600
     LFRQRELGEW NTVVEEMREA LTDWCRTGPI                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page