(data stored in ACNUC7421 zone)

EMBL: CP000271.PE408

CP000271.PE408       Location/Qualifiers
FT   CDS             470345..472615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2617"
FT                   /product="Putative isoquinoline 1-oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.3.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2617"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33376"
FT                   /db_xref="GOA:Q13RB3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB3"
FT                   /protein_id="ABE33376.1"
FT                   /translation="MLKRRTFLLGGAGAVGALLVGWSVLPPGQRLTTSMPLPAQGTQVA
FT                   LNGWVKIAADNSVTIMMCKAEMGQGIHTGLAMLLAEELDADWSQVRVEDSPIDRIYNSV
FT                   QNIIDDLPFRPDDDSAIKRATVWMTRKVVSEAGTMMTGGSSSINDLWTPMREAGASARA
FT                   MLIGAAAAQWKVPAGECRAEGGHVLHPSGHKASFGELSSMAAQQPLPRQVALKDPAGFK
FT                   LIGKPLRRIEAASKINGTARFGIDALPDGLLYASVVMCPTLGGSVARFDATAAGKMPGF
FT                   IKAFAVAPYNGGTGGVAVIADNPFRAMNAVTAVEVDWHDGPAAKLSNADVDRHLAQALD
FT                   DGDGHAYYRLGDVDAALSRAARTVSAEYRAPYLAHGAVEPPNCTVQVTDGSAAVWVSTQ
FT                   MPALARHHVAKVLDLDADKVDVQTLLLGGAFGRRLELDFIAQAAAIAREGGGRPVQTIW
FT                   SRAQDFTHDFYRPACVSRLKAGFDNDGKLVAWQATSASQAIVPESLARYYGVPRIPIDK
FT                   TTCEGAFDQPYEWPAARVAHKIVELPVPVGFWRSVGHSHQAFFTEGFTDELAVAAGQDP
FT                   IAFRAALLAQHPRHLAVLRRVAVLSDWGHPLTHAADGAPRARGVALHEAFGSVVAQVAE
FT                   VSIGPDKGIRVHRVVCVIDCGMPVNPNLIRQQMESAIVFGLSTALQDEISLVNGQVQQK
FT                   NFVDFPVVRINDCPVIDTDIMPSQMHPQGVGEPGVPPVAPAVANAVFALTGQRLRSLPL
FT                   KLA"
     MLKRRTFLLG GAGAVGALLV GWSVLPPGQR LTTSMPLPAQ GTQVALNGWV KIAADNSVTI        60
     MMCKAEMGQG IHTGLAMLLA EELDADWSQV RVEDSPIDRI YNSVQNIIDD LPFRPDDDSA       120
     IKRATVWMTR KVVSEAGTMM TGGSSSINDL WTPMREAGAS ARAMLIGAAA AQWKVPAGEC       180
     RAEGGHVLHP SGHKASFGEL SSMAAQQPLP RQVALKDPAG FKLIGKPLRR IEAASKINGT       240
     ARFGIDALPD GLLYASVVMC PTLGGSVARF DATAAGKMPG FIKAFAVAPY NGGTGGVAVI       300
     ADNPFRAMNA VTAVEVDWHD GPAAKLSNAD VDRHLAQALD DGDGHAYYRL GDVDAALSRA       360
     ARTVSAEYRA PYLAHGAVEP PNCTVQVTDG SAAVWVSTQM PALARHHVAK VLDLDADKVD       420
     VQTLLLGGAF GRRLELDFIA QAAAIAREGG GRPVQTIWSR AQDFTHDFYR PACVSRLKAG       480
     FDNDGKLVAW QATSASQAIV PESLARYYGV PRIPIDKTTC EGAFDQPYEW PAARVAHKIV       540
     ELPVPVGFWR SVGHSHQAFF TEGFTDELAV AAGQDPIAFR AALLAQHPRH LAVLRRVAVL       600
     SDWGHPLTHA ADGAPRARGV ALHEAFGSVV AQVAEVSIGP DKGIRVHRVV CVIDCGMPVN       660
     PNLIRQQMES AIVFGLSTAL QDEISLVNGQ VQQKNFVDFP VVRINDCPVI DTDIMPSQMH       720
     PQGVGEPGVP PVAPAVANAV FALTGQRLRS LPLKLA                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page