(data stored in ACNUC7421 zone)

EMBL: CP000271.PE409

CP000271.PE409       Location/Qualifiers
FT   CDS             472667..473128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2616"
FT                   /product="Putative isoquinoline 1-oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.3.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2616"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33377"
FT                   /db_xref="GOA:Q13RB2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB2"
FT                   /protein_id="ABE33377.1"
FT                   /translation="MGSLNINGRAVAVQADPDMPLLWVLRCELGMTGTKFGCGLGICGA
FT                   CMIHVDGEASFACQTLMSSLHTQKITTIEGLQGAEAQALKAAWIDLDVVQCGYCQSAQL
FT                   MAACALLKHNPKPTDADIDTAMCHIVCRCGTYPRVRAAIHQAAAKRRSA"
     MGSLNINGRA VAVQADPDMP LLWVLRCELG MTGTKFGCGL GICGACMIHV DGEASFACQT        60
     LMSSLHTQKI TTIEGLQGAE AQALKAAWID LDVVQCGYCQ SAQLMAACAL LKHNPKPTDA       120
     DIDTAMCHIV CRCGTYPRVR AAIHQAAAKR RSA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page