(data stored in ACNUC7421 zone)

EMBL: CP000271.PE411

CP000271.PE411       Location/Qualifiers
FT   CDS             complement(475033..476037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2614"
FT                   /product="aromatic acid efflux pump, membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2614"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33379"
FT                   /db_xref="GOA:Q13RB0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB0"
FT                   /protein_id="ABE33379.1"
FT                   /translation="MKKTWFSVGQILLTLIVVVAAALVLWKLVDYYMFAPWTRDGHVRA
FT                   DVIQVAPDISGLISSVEVVDNQQVRQGQVLFVIDQARYTLALRQAQATAQQRRATLDQA
FT                   RREDARNRKLGNLVAAEVSEESRSRVEQGEAALADANVAIDTAKLNLQRATIVSPVDGY
FT                   LNDRAPRAGEFVAAGRAVVSVVDMHSFRVDGYFEETKLRGIGIGQPVDIKVMGEPDVLR
FT                   GHVQSIVAGIEDRDRSQGTNLLPNVNPAFSWVRLAQRIPVRVALDEVPADFRMIAGRTA
FT                   TVSVRDLAPGGKTRPGADAVGAVGAVGASASSSTLATSTVPAASAAVISGASQ"
     MKKTWFSVGQ ILLTLIVVVA AALVLWKLVD YYMFAPWTRD GHVRADVIQV APDISGLISS        60
     VEVVDNQQVR QGQVLFVIDQ ARYTLALRQA QATAQQRRAT LDQARREDAR NRKLGNLVAA       120
     EVSEESRSRV EQGEAALADA NVAIDTAKLN LQRATIVSPV DGYLNDRAPR AGEFVAAGRA       180
     VVSVVDMHSF RVDGYFEETK LRGIGIGQPV DIKVMGEPDV LRGHVQSIVA GIEDRDRSQG       240
     TNLLPNVNPA FSWVRLAQRI PVRVALDEVP ADFRMIAGRT ATVSVRDLAP GGKTRPGADA       300
     VGAVGAVGAS ASSSTLATST VPAASAAVIS GASQ                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page