(data stored in ACNUC7421 zone)

EMBL: CP000271.PE415

CP000271.PE415       Location/Qualifiers
FT   CDS             complement(479102..480760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2610"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2610"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33383"
FT                   /db_xref="GOA:Q13RA6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA6"
FT                   /protein_id="ABE33383.1"
FT                   /translation="MEQRVLILAPFGRDADVIAEVLRKDDRMCVACHDADALTTALDAG
FT                   AGAALIAEEALAGDHAMRLFNWLEQQPAWSDFPFTLLAAPRVGHRSERGLEVLERLGNV
FT                   VVLERPLNSETLRRAVASSLRARARQYETRRHLAERIQAQDALVQLNDSLESRIAERTH
FT                   ELASANNRLMMEIHERAKVQAVLVQSQKMEALGQLTGGIAHDFNNLLNVIMVNAELIAR
FT                   VSSDERLRGMAATVKRATERGAKLTGQLLTFSRNSNLDLKAVDVVTLLQGMRDIITVSL
FT                   GSSIRYTNEFDGAELWTEADANQLELAILNLAINARDAMPAGGQLGIRVKEREAPDQTL
FT                   EAGPYVVIEVADTGSGVPPEVVSRVFDPFFTTKPIGKGTGLGLSQVYGIATQAGGTARL
FT                   FSEEGVGTTVEIWLPLRERVVPQAEATSNAEANAVGEKRVLVVEDDGEVRAMLVESLRM
FT                   LGYTVTEAADGRAGLNRLQDDKPDLLMVDFAMPGMNGIDVIAEARKLREDLPVILATGY
FT                   ADVDISGLAVKRCTILRKPFQLDDLARTVRLGLAA"
     MEQRVLILAP FGRDADVIAE VLRKDDRMCV ACHDADALTT ALDAGAGAAL IAEEALAGDH        60
     AMRLFNWLEQ QPAWSDFPFT LLAAPRVGHR SERGLEVLER LGNVVVLERP LNSETLRRAV       120
     ASSLRARARQ YETRRHLAER IQAQDALVQL NDSLESRIAE RTHELASANN RLMMEIHERA       180
     KVQAVLVQSQ KMEALGQLTG GIAHDFNNLL NVIMVNAELI ARVSSDERLR GMAATVKRAT       240
     ERGAKLTGQL LTFSRNSNLD LKAVDVVTLL QGMRDIITVS LGSSIRYTNE FDGAELWTEA       300
     DANQLELAIL NLAINARDAM PAGGQLGIRV KEREAPDQTL EAGPYVVIEV ADTGSGVPPE       360
     VVSRVFDPFF TTKPIGKGTG LGLSQVYGIA TQAGGTARLF SEEGVGTTVE IWLPLRERVV       420
     PQAEATSNAE ANAVGEKRVL VVEDDGEVRA MLVESLRMLG YTVTEAADGR AGLNRLQDDK       480
     PDLLMVDFAM PGMNGIDVIA EARKLREDLP VILATGYADV DISGLAVKRC TILRKPFQLD       540
     DLARTVRLGL AA                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page