(data stored in ACNUC7421 zone)

EMBL: CP000271.PE419

CP000271.PE419       Location/Qualifiers
FT   CDS             484588..485664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2606"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2606"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33387"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA2"
FT                   /protein_id="ABE33387.1"
FT                   /translation="MTFNLSRRLAVLCAATGAALLMTLAQPAFAVHAYEPHLKPVATVS
FT                   DTRFTLDTPQGHAEFPLYLSKDWSVAQPQVTRAVIVIHGKLRNADVYFRTAQKARDAAH
FT                   ADPDATLLIAPQFLATLDTRVHDEPADLLRWSGDAWMGGDAAQAPLPISSYEVLDAIVA
FT                   RLADRKLFPNLRHVVFAGHSGGGQVVQRYAVAGRNIAALTDEGIDVRYVVASPSTYAYF
FT                   DAQRPNAQGVAAPFDAAQCPDFNQWKYGMDNRPPYLGDRTPAQLEATYAARRIDYLVGG
FT                   ADDDPQQNALDKTCAAEAQGPQRVARAEAYYRYIQSRHPHGLKQRFHIVPGVGHNGSRM
FT                   LTSVCALAAMFDTQGCEQ"
     MTFNLSRRLA VLCAATGAAL LMTLAQPAFA VHAYEPHLKP VATVSDTRFT LDTPQGHAEF        60
     PLYLSKDWSV AQPQVTRAVI VIHGKLRNAD VYFRTAQKAR DAAHADPDAT LLIAPQFLAT       120
     LDTRVHDEPA DLLRWSGDAW MGGDAAQAPL PISSYEVLDA IVARLADRKL FPNLRHVVFA       180
     GHSGGGQVVQ RYAVAGRNIA ALTDEGIDVR YVVASPSTYA YFDAQRPNAQ GVAAPFDAAQ       240
     CPDFNQWKYG MDNRPPYLGD RTPAQLEATY AARRIDYLVG GADDDPQQNA LDKTCAAEAQ       300
     GPQRVARAEA YYRYIQSRHP HGLKQRFHIV PGVGHNGSRM LTSVCALAAM FDTQGCEQ         358
//

If you have problems or comments...

PBIL Back to PBIL home page