(data stored in ACNUC7421 zone)

EMBL: CP000271.PE42

CP000271.PE42        Location/Qualifiers
FT   CDS             complement(44361..45353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2986"
FT                   /product="putative DedA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2986"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33010"
FT                   /db_xref="GOA:Q13SC9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC9"
FT                   /protein_id="ABE33010.1"
FT                   /translation="MLHDLVEQYGPALVFVNVLAASIGLPVPALPSLVLFGAMAAMHPG
FT                   SVGTQLAPVLVLSIFATLIGDSAWYFAGRMYGGNTLKAICRLSLSRDTCVKKTERFFGR
FT                   WGVRVLAVAKFVPGLSIVSIPMAGAMGTRYRTFLTYDSIGAALWSGTGLIIGALFAKQI
FT                   DMLFALAGRLGRTAALVAVALLLAYAAYRWIRRRQLIAKLASARIEVDELAALVKAGNT
FT                   PVLFDIRSHEKRKLDPFVIPGTQFADERQLDEIVATYPRDQKLVIYCSCPNEISAAWMA
FT                   RQLNEAGFSDVLPLRGGMEAWRDSGKPVESLPDMPPPEVAVEDVAPKAV"
     MLHDLVEQYG PALVFVNVLA ASIGLPVPAL PSLVLFGAMA AMHPGSVGTQ LAPVLVLSIF        60
     ATLIGDSAWY FAGRMYGGNT LKAICRLSLS RDTCVKKTER FFGRWGVRVL AVAKFVPGLS       120
     IVSIPMAGAM GTRYRTFLTY DSIGAALWSG TGLIIGALFA KQIDMLFALA GRLGRTAALV       180
     AVALLLAYAA YRWIRRRQLI AKLASARIEV DELAALVKAG NTPVLFDIRS HEKRKLDPFV       240
     IPGTQFADER QLDEIVATYP RDQKLVIYCS CPNEISAAWM ARQLNEAGFS DVLPLRGGME       300
     AWRDSGKPVE SLPDMPPPEV AVEDVAPKAV                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page