(data stored in ACNUC7421 zone)

EMBL: CP000271.PE425

CP000271.PE425       Location/Qualifiers
FT   CDS             489742..490482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2600"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2600"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33393"
FT                   /db_xref="GOA:Q13R96"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R96"
FT                   /protein_id="ABE33393.1"
FT                   /translation="MVGKLLVRGMLAGIAAGLLTFGFARVVGEPQVNQAISFEEKADAA
FT                   KGEAPEPELVSRDTQRGLGLLTGVVVYGAAFGGLFSLVFAYAYGRVGALSARALSAWLA
FT                   LGAFIALAVVPNLKYPANPPSVGDPDTIGMRTGLFFLMIAISLAAMVFSLKVRRRAAAK
FT                   LGAWNGSIVAGLVFVVIIAAVQLSMPAINEVPEAFPAVLLWKFRVAALGMQAIMWTTIG
FT                   LLFGALVERGAFMRVGGGSAVESA"
     MVGKLLVRGM LAGIAAGLLT FGFARVVGEP QVNQAISFEE KADAAKGEAP EPELVSRDTQ        60
     RGLGLLTGVV VYGAAFGGLF SLVFAYAYGR VGALSARALS AWLALGAFIA LAVVPNLKYP       120
     ANPPSVGDPD TIGMRTGLFF LMIAISLAAM VFSLKVRRRA AAKLGAWNGS IVAGLVFVVI       180
     IAAVQLSMPA INEVPEAFPA VLLWKFRVAA LGMQAIMWTT IGLLFGALVE RGAFMRVGGG       240
     SAVESA                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page