(data stored in ACNUC7421 zone)

EMBL: CP000271.PE427

CP000271.PE427       Location/Qualifiers
FT   CDS             491547..493955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2598"
FT                   /product="YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2598"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33395"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R94"
FT                   /protein_id="ABE33395.1"
FT                   /translation="MCAPNVSNNKPIGIRTKKSRLHGETAGFAGRLLAAFSLLIFAFSA
FT                   NAVDCFSLYAQSGATPGSKTCKLDVTSNTPGGMGNYACINDLALIDQWCNSTETPPDDT
FT                   CPVADPVFPANGIVTFSETDFASGDASPLVFSRTYLSKPFDKAQVAMGGYWASNWQRRL
FT                   DLTSVNASTPKITAYRSNGQPLIFKWVNGGWAVPGTSGLSLLKAGDGYFYLKDERLGTT
FT                   ETYSVSTGLFHSETTRTGMYREVEYVGQQIDSIAQWPVDRTGQAASRLTLSLTYDSNGR
FT                   ILSVVPPSGNATHYAYDAKGNLVSVTAPIGYVRQYLYEDARFPNAMTGIKDESGSRIAT
FT                   WTYDSSGRAISVTHPDTTRNVSFSYGANTTTVSNMSGNSTYSFNVGDTSRPGSIVTPGG
FT                   AVSRTWDTSGNLNQTITPDGNTQYTWDGANRPTKAVATVSGNRTVTTIEYSDSTSLRPH
FT                   LVATPGKIRAFVYDQAGNVTGYAETETSDLTGDQGMQAVGTGNQWTVGARYDSASRLLS
FT                   AAITRNGSKREDWTYTYDVRGNVESVQDAVSGWSMRTLSRNAENRATQIAGNSGQASIG
FT                   YDERGRVKSFQYSEPASSLNGGLARVLAVDYRYGPDGSVSSRTAQVSTNGAWWKPISDA
FT                   ELGVWLTNWELGNDPVAPPANLTGLQSDAPAFVPDMCVECYMAWKALPTGKLFGHELGE
FT                   TLPAWREATELMVSDQAQVPYPVLVPDLTSSAKRSTLYSTLFGGGSGDGGMVKCGGSGN
FT                   NEWREADCHAKYMYDMQICNSLGTIMGKSRGRALCKQQAFEDYQECRGH"
     MCAPNVSNNK PIGIRTKKSR LHGETAGFAG RLLAAFSLLI FAFSANAVDC FSLYAQSGAT        60
     PGSKTCKLDV TSNTPGGMGN YACINDLALI DQWCNSTETP PDDTCPVADP VFPANGIVTF       120
     SETDFASGDA SPLVFSRTYL SKPFDKAQVA MGGYWASNWQ RRLDLTSVNA STPKITAYRS       180
     NGQPLIFKWV NGGWAVPGTS GLSLLKAGDG YFYLKDERLG TTETYSVSTG LFHSETTRTG       240
     MYREVEYVGQ QIDSIAQWPV DRTGQAASRL TLSLTYDSNG RILSVVPPSG NATHYAYDAK       300
     GNLVSVTAPI GYVRQYLYED ARFPNAMTGI KDESGSRIAT WTYDSSGRAI SVTHPDTTRN       360
     VSFSYGANTT TVSNMSGNST YSFNVGDTSR PGSIVTPGGA VSRTWDTSGN LNQTITPDGN       420
     TQYTWDGANR PTKAVATVSG NRTVTTIEYS DSTSLRPHLV ATPGKIRAFV YDQAGNVTGY       480
     AETETSDLTG DQGMQAVGTG NQWTVGARYD SASRLLSAAI TRNGSKREDW TYTYDVRGNV       540
     ESVQDAVSGW SMRTLSRNAE NRATQIAGNS GQASIGYDER GRVKSFQYSE PASSLNGGLA       600
     RVLAVDYRYG PDGSVSSRTA QVSTNGAWWK PISDAELGVW LTNWELGNDP VAPPANLTGL       660
     QSDAPAFVPD MCVECYMAWK ALPTGKLFGH ELGETLPAWR EATELMVSDQ AQVPYPVLVP       720
     DLTSSAKRST LYSTLFGGGS GDGGMVKCGG SGNNEWREAD CHAKYMYDMQ ICNSLGTIMG       780
     KSRGRALCKQ QAFEDYQECR GH                                                802
//

If you have problems or comments...

PBIL Back to PBIL home page