(data stored in ACNUC7421 zone)

EMBL: CP000271.PE428

CP000271.PE428       Location/Qualifiers
FT   CDS             493952..494230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2597"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33396"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R93"
FT                   /protein_id="ABE33396.1"
FT                   /translation="MMTSYPPRSVVVTYDEDSQQIVLQLVDPAKLAPLLARTLKAPILL
FT                   EEFDFRLDDEFVRRLGGGLLNLIALGQPEIKQYTTYTQHPIDELPEG"
     MMTSYPPRSV VVTYDEDSQQ IVLQLVDPAK LAPLLARTLK APILLEEFDF RLDDEFVRRL        60
     GGGLLNLIAL GQPEIKQYTT YTQHPIDELP EG                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page