(data stored in ACNUC7421 zone)

EMBL: CP000271.PE429

CP000271.PE429       Location/Qualifiers
FT   CDS             495392..497317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2596"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2596"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33397"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R92"
FT                   /protein_id="ABE33397.1"
FT                   /translation="MASMDPELPAYYQGELHYIHELFQEFAQQHPKIARRLGAQAGEAG
FT                   DPYVERLLQSFAITAARSQMRIDRFSLDIPLRKLDGVDLNLTAPLPSLGVARFYPDAEA
FT                   PHSPQGLTLARGTRLTVHAAEDATECAFLTSQPLRLWPVAITRAKPTGIPADVPALYRY
FT                   VHDGQDASRVRGALRLSLATVNGMAFRGLEALDELPVYLCGEEKMASQLFELIHTSVVG
FT                   IVMGVPGEFEKGGLYGAKLPGMPYMQVKHAGLEPHESLLRPVAAKFHGHRLVHEFFALP
FT                   SRFGFFTITGLAAGLKHIGGPEVEIVLLLAREAATLDQQIGVRDFALYCTPIVNLYPAT
FT                   SERLTMHPEKHEHPLTPVAERPGDYEVHSVDRVRGQLEEESEKFLFQPLDAALPDDTRR
FT                   NSRYFTLRREQQLVADNERRYDTHREFVRTLTSITLLDENRKPDETGMRFLTFDAWLTN
FT                   GDLPCVQPRNGVNDLTMADAKAVESVGFVRGPTAPRPPLALGARGDAAWELVRQFHLEL
FT                   AVFDDEFDEPNPGEGLRLMLRPYLAAGDPAMARVLDSLVGATAGAVNDMHCWGGELHLA
FT                   RGIAVTLTFDESRLDGWSPFAFALVLERYVARHVSAHCFTRTTVRTTQRGEIFTFPTRG
FT                   GTRGVF"
     MASMDPELPA YYQGELHYIH ELFQEFAQQH PKIARRLGAQ AGEAGDPYVE RLLQSFAITA        60
     ARSQMRIDRF SLDIPLRKLD GVDLNLTAPL PSLGVARFYP DAEAPHSPQG LTLARGTRLT       120
     VHAAEDATEC AFLTSQPLRL WPVAITRAKP TGIPADVPAL YRYVHDGQDA SRVRGALRLS       180
     LATVNGMAFR GLEALDELPV YLCGEEKMAS QLFELIHTSV VGIVMGVPGE FEKGGLYGAK       240
     LPGMPYMQVK HAGLEPHESL LRPVAAKFHG HRLVHEFFAL PSRFGFFTIT GLAAGLKHIG       300
     GPEVEIVLLL AREAATLDQQ IGVRDFALYC TPIVNLYPAT SERLTMHPEK HEHPLTPVAE       360
     RPGDYEVHSV DRVRGQLEEE SEKFLFQPLD AALPDDTRRN SRYFTLRREQ QLVADNERRY       420
     DTHREFVRTL TSITLLDENR KPDETGMRFL TFDAWLTNGD LPCVQPRNGV NDLTMADAKA       480
     VESVGFVRGP TAPRPPLALG ARGDAAWELV RQFHLELAVF DDEFDEPNPG EGLRLMLRPY       540
     LAAGDPAMAR VLDSLVGATA GAVNDMHCWG GELHLARGIA VTLTFDESRL DGWSPFAFAL       600
     VLERYVARHV SAHCFTRTTV RTTQRGEIFT FPTRGGTRGV F                           641
//

If you have problems or comments...

PBIL Back to PBIL home page