(data stored in ACNUC7421 zone)

EMBL: CP000271.PE430

CP000271.PE430       Location/Qualifiers
FT   CDS             497330..500068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2595"
FT                   /product="Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2595"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33398"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R91"
FT                   /protein_id="ABE33398.1"
FT                   /translation="MTWNTQSRTLEIVSDAIPEHCGKKIFEPVRCKGTDKLGRLFDYRI
FT                   DVQTIEANGLHVNDMDRLVDVSKLVGKRLTVKIAIEGSGTQESDEQNIGADVRVITGVI
FT                   AEVKCVGADDRRMFYRLRLRCLLWLASLNRDNRHFRDRTVREISDEILKKYPFSVRWNL
FT                   IGAGNGSRNFPKRDYQRQFWESDFSCLNRLWQEWGITFYWDDDTLVLMDNAGYPAHGPA
FT                   CKTVRYLERGGQRIDEEHIHKLEYSRGLTTGKVAGIDYDYTRATNRQFKRRISNHRDAA
FT                   HDNAEEYTWLDYAQPQQGAMGLNAEPNDYEFEGDHLARVRVDAHRNKSLVIKATGNLRG
FT                   VMTGHQLTVAGHPFAPVNRKYIVTGTKIEIVNNDSVTQGGTLQREYTCRTKFTAIPNDH
FT                   YYRTPQKAKKPRAFAEKAVVTGHDKKGVHTDAMARIRVKFIWDRVSQADEEASCWIPLM
FT                   QVWQGQRYGMNFVPRVGDHVYIGFLNMDPDRPFILGSHTTDRNEAPWDLYANHALSGWR
FT                   SQDLDGYGKGSNTVVTDDTPGQLQVQVTSDHANSRFVAGCNVRIDGNTGRSQARGEGIE
FT                   IATDANAVMRANRGMLITTEARDGATAPMKDMGETIARLDEARTLHDRLAGEAQANGAQ
FT                   DSGGDQKAVASAIRAQNRALAGKAGAGKFPEFAQPHVTLASPAGIESTTAGSTHVASGE
FT                   HLAMTSGADVAIAAGGSFFGTFGNKLRMTVQKAGMRLVAVSGDIDLRALKDSINLLARL
FT                   NVTVTAEKITISAKQEVEIRGGGSFTRWSNGKIYHGTPGQFEIHSAGRLFTGPDSASLP
FT                   TLPESAPGQQELHFALGALANGAAHRYVEEPYELYQGNALIDSGVTDSYGRVVVKDHQP
FT                   ETTEYCVKLCYGGQFRLKVKDALNADADHIDQRSNRGDRAV"
     MTWNTQSRTL EIVSDAIPEH CGKKIFEPVR CKGTDKLGRL FDYRIDVQTI EANGLHVNDM        60
     DRLVDVSKLV GKRLTVKIAI EGSGTQESDE QNIGADVRVI TGVIAEVKCV GADDRRMFYR       120
     LRLRCLLWLA SLNRDNRHFR DRTVREISDE ILKKYPFSVR WNLIGAGNGS RNFPKRDYQR       180
     QFWESDFSCL NRLWQEWGIT FYWDDDTLVL MDNAGYPAHG PACKTVRYLE RGGQRIDEEH       240
     IHKLEYSRGL TTGKVAGIDY DYTRATNRQF KRRISNHRDA AHDNAEEYTW LDYAQPQQGA       300
     MGLNAEPNDY EFEGDHLARV RVDAHRNKSL VIKATGNLRG VMTGHQLTVA GHPFAPVNRK       360
     YIVTGTKIEI VNNDSVTQGG TLQREYTCRT KFTAIPNDHY YRTPQKAKKP RAFAEKAVVT       420
     GHDKKGVHTD AMARIRVKFI WDRVSQADEE ASCWIPLMQV WQGQRYGMNF VPRVGDHVYI       480
     GFLNMDPDRP FILGSHTTDR NEAPWDLYAN HALSGWRSQD LDGYGKGSNT VVTDDTPGQL       540
     QVQVTSDHAN SRFVAGCNVR IDGNTGRSQA RGEGIEIATD ANAVMRANRG MLITTEARDG       600
     ATAPMKDMGE TIARLDEART LHDRLAGEAQ ANGAQDSGGD QKAVASAIRA QNRALAGKAG       660
     AGKFPEFAQP HVTLASPAGI ESTTAGSTHV ASGEHLAMTS GADVAIAAGG SFFGTFGNKL       720
     RMTVQKAGMR LVAVSGDIDL RALKDSINLL ARLNVTVTAE KITISAKQEV EIRGGGSFTR       780
     WSNGKIYHGT PGQFEIHSAG RLFTGPDSAS LPTLPESAPG QQELHFALGA LANGAAHRYV       840
     EEPYELYQGN ALIDSGVTDS YGRVVVKDHQ PETTEYCVKL CYGGQFRLKV KDALNADADH       900
     IDQRSNRGDR AV                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page