(data stored in ACNUC7421 zone)

EMBL: CP000271.PE434

CP000271.PE434       Location/Qualifiers
FT   CDS             505213..506610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2591"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33402"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R87"
FT                   /protein_id="ABE33402.1"
FT                   /translation="MKLERCLSHTYMKFARVRYLFSLWLLFAMTQAALAESPIHQLMTA
FT                   MSSSDSPRYTKLPLFAPHRKDFTCVYQEQHLPPVDPQAELWFQQALASELDPNIYWEDK
FT                   DWRKIYQLYQQAAERNHWKAMLNLAALILSGYPVPVRDPEMAIRWVEKAMQLEVPDAWD
FT                   TMGVYHMKGIVKGGDATSAYAFFQKAADMGSPSAQTFLGAALNAGWDNPGSGFWANISV
FT                   ATKMLECSLAQGYGDAADELEFIYAAPRTPEARLRAVTVLQEGAKLGSAKCASLLGSQF
FT                   RGMGLSDGKSLVGYVDKARAERYSKISDILEWYEGTLKLPNLDKVLPLPPAALPKWDGD
FT                   VQTLIDAAKAVTPPPTSPAHPSQSEPHAALTKAGLLRQLADRPEPLRCNGGLKCPQSGI
FT                   WEARVAAAHPLAALYNRWDRQAFVEKEASFPDPRQQHLDISAHDVRWTWLGSPNQLRVA
FT                   DVYDIAL"
     MKLERCLSHT YMKFARVRYL FSLWLLFAMT QAALAESPIH QLMTAMSSSD SPRYTKLPLF        60
     APHRKDFTCV YQEQHLPPVD PQAELWFQQA LASELDPNIY WEDKDWRKIY QLYQQAAERN       120
     HWKAMLNLAA LILSGYPVPV RDPEMAIRWV EKAMQLEVPD AWDTMGVYHM KGIVKGGDAT       180
     SAYAFFQKAA DMGSPSAQTF LGAALNAGWD NPGSGFWANI SVATKMLECS LAQGYGDAAD       240
     ELEFIYAAPR TPEARLRAVT VLQEGAKLGS AKCASLLGSQ FRGMGLSDGK SLVGYVDKAR       300
     AERYSKISDI LEWYEGTLKL PNLDKVLPLP PAALPKWDGD VQTLIDAAKA VTPPPTSPAH       360
     PSQSEPHAAL TKAGLLRQLA DRPEPLRCNG GLKCPQSGIW EARVAAAHPL AALYNRWDRQ       420
     AFVEKEASFP DPRQQHLDIS AHDVRWTWLG SPNQLRVADV YDIAL                       465
//

If you have problems or comments...

PBIL Back to PBIL home page