(data stored in ACNUC7421 zone)

EMBL: CP000271.PE436

CP000271.PE436       Location/Qualifiers
FT   CDS             508125..508388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2589"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2589"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33404"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R85"
FT                   /protein_id="ABE33404.1"
FT                   /translation="MTRQIIVTGDTLAPFGGEVIEGSEMDNIDGRKIARKSDRVYCAEH
FT                   GVNPIAEGDDSTLVDDRPVALEGHRASCGCTLVSRQQTLSVA"
     MTRQIIVTGD TLAPFGGEVI EGSEMDNIDG RKIARKSDRV YCAEHGVNPI AEGDDSTLVD        60
     DRPVALEGHR ASCGCTLVSR QQTLSVA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page