(data stored in ACNUC7421 zone)

EMBL: CP000271.PE437

CP000271.PE437       Location/Qualifiers
FT   CDS             508531..509589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2588"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2588"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33405"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R84"
FT                   /protein_id="ABE33405.1"
FT                   /translation="MKRAAPNVAMSVNLLDDLVATPWRHGFIALMRRINADPAIAPVGT
FT                   ALLPYSEPFRIGQKPSLVFAPSEVAEARIKDNRLHIRLHSLGMLGPNGPLPIHVTEIAR
FT                   EREALRGDTTLSNFLDVFHHRSLALLYRAWASAQAAASLDRPDHDRFSFYVGCVSGTSP
FT                   GRDRTVRLPSHARLASGAHLVHEARNPDALAMTVAHRFHVPARIDEWSLHWTVLPPKLQ
FT                   CRVGQERMSAILGGGAVLGEQVPGRMHRFCLVLGPLDIETYHRLTPRGADLLRLIALVR
FT                   AHMGLEYEWLLELQIRPQDATCASLGDNQQLGWSGWLGEPPAGEPVVGMRFEPELYVKQ
FT                   LVRNMQHTRRQA"
     MKRAAPNVAM SVNLLDDLVA TPWRHGFIAL MRRINADPAI APVGTALLPY SEPFRIGQKP        60
     SLVFAPSEVA EARIKDNRLH IRLHSLGMLG PNGPLPIHVT EIAREREALR GDTTLSNFLD       120
     VFHHRSLALL YRAWASAQAA ASLDRPDHDR FSFYVGCVSG TSPGRDRTVR LPSHARLASG       180
     AHLVHEARNP DALAMTVAHR FHVPARIDEW SLHWTVLPPK LQCRVGQERM SAILGGGAVL       240
     GEQVPGRMHR FCLVLGPLDI ETYHRLTPRG ADLLRLIALV RAHMGLEYEW LLELQIRPQD       300
     ATCASLGDNQ QLGWSGWLGE PPAGEPVVGM RFEPELYVKQ LVRNMQHTRR QA               352
//

If you have problems or comments...

PBIL Back to PBIL home page