(data stored in ACNUC7421 zone)

EMBL: CP000271.PE438

CP000271.PE438       Location/Qualifiers
FT   CDS             complement(509754..511670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2587"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2587"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33406"
FT                   /db_xref="GOA:Q13R83"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R83"
FT                   /protein_id="ABE33406.1"
FT                   /translation="MIAAAFSRVADRLLAADPGLVRLHTALRVALACLLTGVASIAWTA
FT                   SRHHPITLAAPGILFAMVAPLFVRDARRPAWFGTLVCLYLCACACFAAASVLSRFPLAG
FT                   DAGFLVVMFVGMLCQACGPRALGCAMLGVVCFYLGLYLHPSTTHLVQSLLLSAFGPLMV
FT                   ALVGRVIVPTRAATSLRLAVHTVTLRASRVLHAPVAAHLSALNEAALSLEEQLALLNPS
FT                   DAETIRERIAEVEVAAGQYAFASGHADGGVEANARVLRHAIARLRETAHQGNDARRAAF
FT                   APAGGAVALTASQRFADLRSKLCWLPATRATTAALLAMLIGHSLSPERWFWAVITTFVV
FT                   FLGTRSRADTVYRGAQRLVGTLGGALVSVSLVAPLQDSPVLLVAAMLLCVFGWAYFILN
FT                   AYAPGVFFITVLVGLVYGELGFAMGPLVELRIEEVLVGCVVSFAVAILMMPLAATRHVE
FT                   TRLASVLGALREVVRLTGSGALAADALPAMRKLDRSWHDLRIALRPLQTQRVVVWNPDV
FT                   ELATGSLLCCLHWARVLSDSARRGGLREKTALNAAEVGAAHVESIVARLDSLIARYNGV
FT                   ARAAGGDSDERASVTIDADIDVHKAPALAQLDGAVAQLFDRLMRPVSDARRVFNWTLRG
FT                   RSV"
     MIAAAFSRVA DRLLAADPGL VRLHTALRVA LACLLTGVAS IAWTASRHHP ITLAAPGILF        60
     AMVAPLFVRD ARRPAWFGTL VCLYLCACAC FAAASVLSRF PLAGDAGFLV VMFVGMLCQA       120
     CGPRALGCAM LGVVCFYLGL YLHPSTTHLV QSLLLSAFGP LMVALVGRVI VPTRAATSLR       180
     LAVHTVTLRA SRVLHAPVAA HLSALNEAAL SLEEQLALLN PSDAETIRER IAEVEVAAGQ       240
     YAFASGHADG GVEANARVLR HAIARLRETA HQGNDARRAA FAPAGGAVAL TASQRFADLR       300
     SKLCWLPATR ATTAALLAML IGHSLSPERW FWAVITTFVV FLGTRSRADT VYRGAQRLVG       360
     TLGGALVSVS LVAPLQDSPV LLVAAMLLCV FGWAYFILNA YAPGVFFITV LVGLVYGELG       420
     FAMGPLVELR IEEVLVGCVV SFAVAILMMP LAATRHVETR LASVLGALRE VVRLTGSGAL       480
     AADALPAMRK LDRSWHDLRI ALRPLQTQRV VVWNPDVELA TGSLLCCLHW ARVLSDSARR       540
     GGLREKTALN AAEVGAAHVE SIVARLDSLI ARYNGVARAA GGDSDERASV TIDADIDVHK       600
     APALAQLDGA VAQLFDRLMR PVSDARRVFN WTLRGRSV                               638
//

If you have problems or comments...

PBIL Back to PBIL home page