(data stored in ACNUC7421 zone)

EMBL: CP000271.PE439

CP000271.PE439       Location/Qualifiers
FT   CDS             complement(511986..512798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2586"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2586"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33407"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R82"
FT                   /protein_id="ABE33407.1"
FT                   /translation="MDTIAKGRQSHSLELEFGAGATPKPDSKGSAAQADGSLAQRVGAI
FT                   DWFDVEQGLNAYGSAMLHNLLSAGECDALTALYRRESLFRSRVVMARHGFGRGEYKYFA
FT                   YPLPPLIAELRSTLYPCLAPVANRWNEVMDIGVRYPATHAEFIERCHAAGQTRPTPLML
FT                   QYAIDDYNCLHQDLYGEHVFPLQVAILLSEPGADFTGGEFVMTEQRPRMQSRTEVVPLG
FT                   KGDAVVFAVHHRPVQGTRGPYRVNLRHGVSRLRSGQRHTLGVIFHDAT"
     MDTIAKGRQS HSLELEFGAG ATPKPDSKGS AAQADGSLAQ RVGAIDWFDV EQGLNAYGSA        60
     MLHNLLSAGE CDALTALYRR ESLFRSRVVM ARHGFGRGEY KYFAYPLPPL IAELRSTLYP       120
     CLAPVANRWN EVMDIGVRYP ATHAEFIERC HAAGQTRPTP LMLQYAIDDY NCLHQDLYGE       180
     HVFPLQVAIL LSEPGADFTG GEFVMTEQRP RMQSRTEVVP LGKGDAVVFA VHHRPVQGTR       240
     GPYRVNLRHG VSRLRSGQRH TLGVIFHDAT                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page