(data stored in ACNUC7421 zone)

EMBL: CP000271.PE440

CP000271.PE440       Location/Qualifiers
FT   CDS             513099..513941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2585"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2585"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33408"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R81"
FT                   /protein_id="ABE33408.1"
FT                   /translation="MSAAPQKLEDWLGKEAVAQDDITAFPLAAMAATLDREENGGTVPP
FT                   LWHWLYFLPIAPMSEVGPDGHPKRGGFLPPVPLPRRMWAGGRLTFHAPLKVGERATRTS
FT                   IIANIEDKTGRSGRLVFVTVQHTIEAGGELKLEEEHDIVYRDAPHEGARPPQPQLAPEG
FT                   EMWRRTIDADPVLLFRYSALTFNGHRIHYDSPYVTQVEGYPGLVVHGPLIATLLVDLVR
FT                   REQPDATFQSFAFKAVRPTFAGQAFTVCGKPSADGKVIDLWAKDHEGCLTMRATAALA"
     MSAAPQKLED WLGKEAVAQD DITAFPLAAM AATLDREENG GTVPPLWHWL YFLPIAPMSE        60
     VGPDGHPKRG GFLPPVPLPR RMWAGGRLTF HAPLKVGERA TRTSIIANIE DKTGRSGRLV       120
     FVTVQHTIEA GGELKLEEEH DIVYRDAPHE GARPPQPQLA PEGEMWRRTI DADPVLLFRY       180
     SALTFNGHRI HYDSPYVTQV EGYPGLVVHG PLIATLLVDL VRREQPDATF QSFAFKAVRP       240
     TFAGQAFTVC GKPSADGKVI DLWAKDHEGC LTMRATAALA                             280
//

If you have problems or comments...

PBIL Back to PBIL home page