(data stored in ACNUC7421 zone)

EMBL: CP000271.PE442

CP000271.PE442       Location/Qualifiers
FT   CDS             515153..516331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2583"
FT                   /product="Putative CAIB/BAIF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2583"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33410"
FT                   /db_xref="GOA:Q13R79"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R79"
FT                   /protein_id="ABE33410.1"
FT                   /translation="MRPLDGIKVVTLEHAIAAPFCTRQLADLGARVIKIERPGVGDFAR
FT                   GYDERVHGLSSHFVWTNRSKESLSLDLKQPAAAEILDALVVDADVLVQNLAPGAADRLG
FT                   LGYDALSKKYPKLIVCDISGYGADGPYRDKKAYDLLIQSESGFLSITGSPGQPAKAGCS
FT                   IADIAAGMYAYSNILSALLLRGRTGHGCRIDVSMLESMVEWMGYPLYYAIDGQAPPALS
FT                   GAAHATIYPYGPFPAGDGKTVMLGLQNEREWKLFCERVLEQPELATDERFASNSKRTLA
FT                   REALREVIVAAFAKLSAAQVIERLDDAGIANAQMNTLADVWAHPQLKARERWHEVGTAA
FT                   GVVQALLPPGMPADFEPRMDPVPALGEHTDAILRELGYDSARIDALRAAGAI"
     MRPLDGIKVV TLEHAIAAPF CTRQLADLGA RVIKIERPGV GDFARGYDER VHGLSSHFVW        60
     TNRSKESLSL DLKQPAAAEI LDALVVDADV LVQNLAPGAA DRLGLGYDAL SKKYPKLIVC       120
     DISGYGADGP YRDKKAYDLL IQSESGFLSI TGSPGQPAKA GCSIADIAAG MYAYSNILSA       180
     LLLRGRTGHG CRIDVSMLES MVEWMGYPLY YAIDGQAPPA LSGAAHATIY PYGPFPAGDG       240
     KTVMLGLQNE REWKLFCERV LEQPELATDE RFASNSKRTL AREALREVIV AAFAKLSAAQ       300
     VIERLDDAGI ANAQMNTLAD VWAHPQLKAR ERWHEVGTAA GVVQALLPPG MPADFEPRMD       360
     PVPALGEHTD AILRELGYDS ARIDALRAAG AI                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page