(data stored in ACNUC7421 zone)

EMBL: CP000271.PE443

CP000271.PE443       Location/Qualifiers
FT   CDS             516400..517884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2582"
FT                   /product="Putative MmgE/Prp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2582"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33411"
FT                   /db_xref="GOA:Q13R78"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R78"
FT                   /protein_id="ABE33411.1"
FT                   /translation="MNDHPSLTLATFAAQLDFNSIPPAVVERTVNLYVDWLGSALAGKG
FT                   ARPVETIARFAREASGASKDGACEVLIDRSRATPYFAAMINGAASHFAEQDDVHNGSVF
FT                   HPATVVFPVALALAQARRASGRDLIAAAVAGYEVGIRVGEFLGRSHYKVFHTTGTAGTV
FT                   AAAATAGRLLGLSPTQMLDAFGSAGTQASGLWEFLRDAADSKQLHTAMAAANGLMAAQL
FT                   AADGFKGATHILEGAQGMAAGMSSDADPARLVDRLGSRWATAETSFKYHAACRHTHPAA
FT                   DALLAVVQEHRLAPRDMAKVVAHVHQGALDVLGAVVTPRTVHQAKFNMGTVLGLVAYHG
FT                   YAGVTEFEQGFDADEIAAFRANVEMAFDAEVDAAYPARWIGKVTVTTTDGRTLAGRVDE
FT                   PKGDPGNTLSRDEIATKLHRLAAFSGAATEGEAARLLGNAWRIVGQAQVGSVFESQSNA
FT                   ESNAGSNAGANAGANAGANAGANAGANAGANAAAAA"
     MNDHPSLTLA TFAAQLDFNS IPPAVVERTV NLYVDWLGSA LAGKGARPVE TIARFAREAS        60
     GASKDGACEV LIDRSRATPY FAAMINGAAS HFAEQDDVHN GSVFHPATVV FPVALALAQA       120
     RRASGRDLIA AAVAGYEVGI RVGEFLGRSH YKVFHTTGTA GTVAAAATAG RLLGLSPTQM       180
     LDAFGSAGTQ ASGLWEFLRD AADSKQLHTA MAAANGLMAA QLAADGFKGA THILEGAQGM       240
     AAGMSSDADP ARLVDRLGSR WATAETSFKY HAACRHTHPA ADALLAVVQE HRLAPRDMAK       300
     VVAHVHQGAL DVLGAVVTPR TVHQAKFNMG TVLGLVAYHG YAGVTEFEQG FDADEIAAFR       360
     ANVEMAFDAE VDAAYPARWI GKVTVTTTDG RTLAGRVDEP KGDPGNTLSR DEIATKLHRL       420
     AAFSGAATEG EAARLLGNAW RIVGQAQVGS VFESQSNAES NAGSNAGANA GANAGANAGA       480
     NAGANAGANA AAAA                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page