(data stored in ACNUC7421 zone)

EMBL: CP000271.PE444

CP000271.PE444       Location/Qualifiers
FT   CDS             517881..518717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2581"
FT                   /product="Putative citrate lyase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2581"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33412"
FT                   /db_xref="GOA:Q13R77"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R77"
FT                   /protein_id="ABE33412.1"
FT                   /translation="MSAALPRSYLFVPGNRPERFEKAHASGADAVILDLEDAVPPDEKP
FT                   AARAVVLAAVSGDATGPAARPEARPAWVRINGADTSWFNEDIAALAGQAGVAGIVLPKA
FT                   ETREQIEAVLALAHSASSVLPIVETARGFANLAVLCAAPRVQRIVFGTLDFQIDLGIDG
FT                   DGEELHLFRSQIVLASRLAGIGAPVDGVSTTITDTDGIEAEARRGRRFGFGAKLCIHPR
FT                   QIDAVHRAYAWSEADKAWAQRVLAAVETSQGAAVAVDGKMVDMPVILKARRIAAGA"
     MSAALPRSYL FVPGNRPERF EKAHASGADA VILDLEDAVP PDEKPAARAV VLAAVSGDAT        60
     GPAARPEARP AWVRINGADT SWFNEDIAAL AGQAGVAGIV LPKAETREQI EAVLALAHSA       120
     SSVLPIVETA RGFANLAVLC AAPRVQRIVF GTLDFQIDLG IDGDGEELHL FRSQIVLASR       180
     LAGIGAPVDG VSTTITDTDG IEAEARRGRR FGFGAKLCIH PRQIDAVHRA YAWSEADKAW       240
     AQRVLAAVET SQGAAVAVDG KMVDMPVILK ARRIAAGA                               278
//

If you have problems or comments...

PBIL Back to PBIL home page