(data stored in ACNUC7421 zone)

EMBL: CP000271.PE445

CP000271.PE445       Location/Qualifiers
FT   CDS             complement(518827..519279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2580"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2580"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33413"
FT                   /db_xref="GOA:Q13R76"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R76"
FT                   /protein_id="ABE33413.1"
FT                   /translation="MAILPAPLSRPGREHPRPGATDISGISKMSRVLLVDDQPEALSAL
FT                   RAVLVGRGYTVATAADGAEAFERLQRTRVSAVVCDWRMPNMDGAELIESMQARSELASV
FT                   PVILTSGSGEVPAFPVKGFLRKPFALDKLLSLLAECESDAATPAVC"
     MAILPAPLSR PGREHPRPGA TDISGISKMS RVLLVDDQPE ALSALRAVLV GRGYTVATAA        60
     DGAEAFERLQ RTRVSAVVCD WRMPNMDGAE LIESMQARSE LASVPVILTS GSGEVPAFPV       120
     KGFLRKPFAL DKLLSLLAEC ESDAATPAVC                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page