(data stored in ACNUC7421 zone)

EMBL: CP000271.PE45

CP000271.PE45        Location/Qualifiers
FT   CDS             48549..52052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2983"
FT                   /product="Periplasmic sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2983"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33013"
FT                   /db_xref="GOA:Q13SC6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC6"
FT                   /protein_id="ABE33013.1"
FT                   /translation="MQKILDRTQESLALAFATLAQNAKRQQRVYLATIGSLMLVVAIFA
FT                   LVLAVVAGLAQLDYRRTFASQNATDISLLLHQEESFSRRVELTFDYYYTAPHVRSAPEA
FT                   VQQSIRRTGVVRGKVDRIDAGFDMLVGEATTTAWGPQLGEKLGRLYEASQSTLATQQAF
FT                   ELQQRATLVGLTEDYAVILPSLAQPVAGKAAAAKLSAVPQQQLAFVRTLRETLERQLEA
FT                   QTGRRLPGKGERVWLGPYLDPLENVPVISAVSVYYDGGTPTTLISMNIRLDVLARRIAP
FT                   PGDEGTILLMAADRRIIASSKPLGMQTGKMLQQTVAATPSHVFHYGREGVIFHEPLGPG
FT                   FGFLVGYLPWGALAVALGWQLAVIAALTALILLAVALTARYFGFRLLRNAFAETSRSLE
FT                   SETINHVLVSATPVGLCVVRQGDYSVLTANALAAELLSIEPGGNRLPPHIVGEFLAQTP
FT                   GKPSAAAIARIAAFVVAARPQSPASAPSEEGAPPARFLQFTYAPARYAGENVLFCAILD
FT                   VTAQTLLEQQLRHAQQTSDAMMRARTNFFAAMSHEIRTPLNALLGNLELFARTPGLEAH
FT                   SQRLATLSVASDALRRVVNDILDFSKIDAGEMLLANEPFRPIDEFENIAFSHAPLCGDR
FT                   AIRFYALLSPTLDCTLIGDRMRIAQVVNNLLSNAFKFTSSGKITLYAEVKDDPQGRPTL
FT                   LCRISDSGAGMSEELLARLFKPFVQGALGTSRGTGGTGLGLVICARLCELMGGRISAES
FT                   VPGVGSVFHVSIPLVAVPGDQRTPVAIPASRGTALVLCTERQAGEFLDGWLQRAGWSSH
FT                   TVMSLAGAEAWLKANRPAVLIVSGEYDLEAIVGLRALQAVGVVWITSGGPTRPEARAQG
FT                   VLEVSEFSRTACLTAIELAVEGASAAPAEASAAASALTPSVEIDPALLGLAVLVAEDNP
FT                   LIQNLIAEQLVELGCVPTIAADGKQALALFERAPFEVVLTDVHMPVMDGHELLTALRER
FT                   HAELPVLAFSAAAEEQQAQSWHERGFNGYVSKPASLSELQAALLAVVPAPARAARAKAA
FT                   STAESASADSVAPVANVASMLSADDKARYTAMLREHLQKDLPRLLAIVEEEDVRALAGW
FT                   AHSASGAFVVVQEPEFFDQCRQLQRLCADNSEWTTEMDERAISLHEALSDHYGLDEQPA
FT                   R"
     MQKILDRTQE SLALAFATLA QNAKRQQRVY LATIGSLMLV VAIFALVLAV VAGLAQLDYR        60
     RTFASQNATD ISLLLHQEES FSRRVELTFD YYYTAPHVRS APEAVQQSIR RTGVVRGKVD       120
     RIDAGFDMLV GEATTTAWGP QLGEKLGRLY EASQSTLATQ QAFELQQRAT LVGLTEDYAV       180
     ILPSLAQPVA GKAAAAKLSA VPQQQLAFVR TLRETLERQL EAQTGRRLPG KGERVWLGPY       240
     LDPLENVPVI SAVSVYYDGG TPTTLISMNI RLDVLARRIA PPGDEGTILL MAADRRIIAS       300
     SKPLGMQTGK MLQQTVAATP SHVFHYGREG VIFHEPLGPG FGFLVGYLPW GALAVALGWQ       360
     LAVIAALTAL ILLAVALTAR YFGFRLLRNA FAETSRSLES ETINHVLVSA TPVGLCVVRQ       420
     GDYSVLTANA LAAELLSIEP GGNRLPPHIV GEFLAQTPGK PSAAAIARIA AFVVAARPQS       480
     PASAPSEEGA PPARFLQFTY APARYAGENV LFCAILDVTA QTLLEQQLRH AQQTSDAMMR       540
     ARTNFFAAMS HEIRTPLNAL LGNLELFART PGLEAHSQRL ATLSVASDAL RRVVNDILDF       600
     SKIDAGEMLL ANEPFRPIDE FENIAFSHAP LCGDRAIRFY ALLSPTLDCT LIGDRMRIAQ       660
     VVNNLLSNAF KFTSSGKITL YAEVKDDPQG RPTLLCRISD SGAGMSEELL ARLFKPFVQG       720
     ALGTSRGTGG TGLGLVICAR LCELMGGRIS AESVPGVGSV FHVSIPLVAV PGDQRTPVAI       780
     PASRGTALVL CTERQAGEFL DGWLQRAGWS SHTVMSLAGA EAWLKANRPA VLIVSGEYDL       840
     EAIVGLRALQ AVGVVWITSG GPTRPEARAQ GVLEVSEFSR TACLTAIELA VEGASAAPAE       900
     ASAAASALTP SVEIDPALLG LAVLVAEDNP LIQNLIAEQL VELGCVPTIA ADGKQALALF       960
     ERAPFEVVLT DVHMPVMDGH ELLTALRERH AELPVLAFSA AAEEQQAQSW HERGFNGYVS      1020
     KPASLSELQA ALLAVVPAPA RAARAKAAST AESASADSVA PVANVASMLS ADDKARYTAM      1080
     LREHLQKDLP RLLAIVEEED VRALAGWAHS ASGAFVVVQE PEFFDQCRQL QRLCADNSEW      1140
     TTEMDERAIS LHEALSDHYG LDEQPAR                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page