(data stored in ACNUC7421 zone)

EMBL: CP000271.PE450

CP000271.PE450       Location/Qualifiers
FT   CDS             525342..527150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2575"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2575"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33418"
FT                   /db_xref="InterPro:IPR018671"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R71"
FT                   /protein_id="ABE33418.1"
FT                   /translation="MKMSRKKIAILVVGLLVVAGVIIQAVWRPFAHRKAAGNGEIVLDI
FT                   HHPDAVIDSEALSRLPRDILSVPLLRDVLTQDFVDYYESDNTRLSAEGALRRLAFEHQL
FT                   DWRDELIRRVFDEPAHVLLWRSPDGRLGYWVMSMHRNGFAKLLQGVGNVATSDAQLSQV
FT                   AKLSGDVPVYALKLAVGRTLLFASKDDRLVVLSAPGVLLDEKGGLLGERADVVSGMLSS
FT                   GRDDAARAYQLDAPGESPKGHRLVVSANYLSFGYQAFFSGIDALRFDFSSTGNPAGGRG
FT                   VANWQTSALIVPDKLPQQWNSADLWRALPANPAACTSLPADWKEASGLLGKVAGGGADN
FT                   AAAIGDQLTGPAAVCWYAKSTLVAPVFVARVKKQDAADIAALKTALGKTFGDVIGAYEA
FT                   KAAKADGADSAGYRRLPVTTREQGADVTVWQRPVSARSGTALTSKASFASQLSAERYFP
FT                   VTLALAHGYLIFSPDGRLVDDTLAVLDKRYPALADTLAPQRLPRTILTLTPSSAAALIE
FT                   REAGAALPADQEAVFRNASRTHLVPKLHALAHYPPVSLTLPQNLPGSTGWVPVEWWFDR
FT                   ARAGAGSGSTEGAADTPADQPGTGGD"
     MKMSRKKIAI LVVGLLVVAG VIIQAVWRPF AHRKAAGNGE IVLDIHHPDA VIDSEALSRL        60
     PRDILSVPLL RDVLTQDFVD YYESDNTRLS AEGALRRLAF EHQLDWRDEL IRRVFDEPAH       120
     VLLWRSPDGR LGYWVMSMHR NGFAKLLQGV GNVATSDAQL SQVAKLSGDV PVYALKLAVG       180
     RTLLFASKDD RLVVLSAPGV LLDEKGGLLG ERADVVSGML SSGRDDAARA YQLDAPGESP       240
     KGHRLVVSAN YLSFGYQAFF SGIDALRFDF SSTGNPAGGR GVANWQTSAL IVPDKLPQQW       300
     NSADLWRALP ANPAACTSLP ADWKEASGLL GKVAGGGADN AAAIGDQLTG PAAVCWYAKS       360
     TLVAPVFVAR VKKQDAADIA ALKTALGKTF GDVIGAYEAK AAKADGADSA GYRRLPVTTR       420
     EQGADVTVWQ RPVSARSGTA LTSKASFASQ LSAERYFPVT LALAHGYLIF SPDGRLVDDT       480
     LAVLDKRYPA LADTLAPQRL PRTILTLTPS SAAALIEREA GAALPADQEA VFRNASRTHL       540
     VPKLHALAHY PPVSLTLPQN LPGSTGWVPV EWWFDRARAG AGSGSTEGAA DTPADQPGTG       600
     GD                                                                      602
//

If you have problems or comments...

PBIL Back to PBIL home page