(data stored in ACNUC7421 zone)

EMBL: CP000271.PE451

CP000271.PE451       Location/Qualifiers
FT   CDS             527343..528116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2574"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2574"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33419"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009558"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R70"
FT                   /protein_id="ABE33419.1"
FT                   /translation="MQSTHAAQSTHAAQSTHAAQSTTLAVHAATTSRRAWLASAACAFA
FT                   VASLTPYAHALTDTAASPDPDALSPQQSAAFRAWFVRIVDQQMRRGPTPRWTQRDCAGL
FT                   VRFAVGETLRPHDTRWLRANGMTSLADTSSMPPELQLSAAQRGIANRWTQLDGSTGAYA
FT                   SAIALIQRNSRFVSKDVNQALPGDLLFFDQGDDQHLMIWLDRYIAYHTGTVTLTDTGLR
FT                   AVSVSDLMQWKDSRWQPLDGNPNFVGVFRLDFLTP"
     MQSTHAAQST HAAQSTHAAQ STTLAVHAAT TSRRAWLASA ACAFAVASLT PYAHALTDTA        60
     ASPDPDALSP QQSAAFRAWF VRIVDQQMRR GPTPRWTQRD CAGLVRFAVG ETLRPHDTRW       120
     LRANGMTSLA DTSSMPPELQ LSAAQRGIAN RWTQLDGSTG AYASAIALIQ RNSRFVSKDV       180
     NQALPGDLLF FDQGDDQHLM IWLDRYIAYH TGTVTLTDTG LRAVSVSDLM QWKDSRWQPL       240
     DGNPNFVGVF RLDFLTP                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page