(data stored in ACNUC7421 zone)

EMBL: CP000271.PE453

CP000271.PE453       Location/Qualifiers
FT   CDS             533100..534728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2572"
FT                   /product="Signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2572"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33421"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR018748"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R68"
FT                   /protein_id="ABE33421.1"
FT                   /translation="MLRFAWLRDGRSQLWQVDGSGAAVGFSPQAAGALPRTLQTPLGSV
FT                   WKLFVYGYLVDRNVTTPDYACNGGDPEEVYCCMTGGHIDREHALVQSCGLFFEPARLQL
FT                   DSADWRKYWTAAHAPAWLRDLHTMTPAHRVPVTELLAALQAMPARPREAAASTLVSVLT
FT                   SGRGEGTVSLYGSVLRAKTWTMPDPARPGASIGGAAGWLADGTPVWLGGSGGSARVLTA
FT                   AAPRLAPLLAQISVPDDAACVLIDFFSRYPIREVVGDKGPAAAPKGPLRGNFRVGFVNG
FT                   NWARVTSRGELRLDRDAAGAPHVVGRFGMNDYVARVVEREGDTSEPEAAKALAVAARTY
FT                   VVQHGNHDHGCFRIDDSSSTQRVLPRAPTAAARHAADLTDALVLTGAPVQYHHDEAAPG
FT                   QMSWLAAKASAQTGLTFDAILARTWPQATLTSFQSPLSGDCIAVAGAQAWLQRNAPLWA
FT                   RRMDGAAGYETPDLPAVCAVREGRPYADAQRNRVYVYRLQTEEDRIALAHEYVHLAFQH
FT                   HPRGLDETFVERTARTLIRTDNPIQ"
     MLRFAWLRDG RSQLWQVDGS GAAVGFSPQA AGALPRTLQT PLGSVWKLFV YGYLVDRNVT        60
     TPDYACNGGD PEEVYCCMTG GHIDREHALV QSCGLFFEPA RLQLDSADWR KYWTAAHAPA       120
     WLRDLHTMTP AHRVPVTELL AALQAMPARP REAAASTLVS VLTSGRGEGT VSLYGSVLRA       180
     KTWTMPDPAR PGASIGGAAG WLADGTPVWL GGSGGSARVL TAAAPRLAPL LAQISVPDDA       240
     ACVLIDFFSR YPIREVVGDK GPAAAPKGPL RGNFRVGFVN GNWARVTSRG ELRLDRDAAG       300
     APHVVGRFGM NDYVARVVER EGDTSEPEAA KALAVAARTY VVQHGNHDHG CFRIDDSSST       360
     QRVLPRAPTA AARHAADLTD ALVLTGAPVQ YHHDEAAPGQ MSWLAAKASA QTGLTFDAIL       420
     ARTWPQATLT SFQSPLSGDC IAVAGAQAWL QRNAPLWARR MDGAAGYETP DLPAVCAVRE       480
     GRPYADAQRN RVYVYRLQTE EDRIALAHEY VHLAFQHHPR GLDETFVERT ARTLIRTDNP       540
     IQ                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page