(data stored in ACNUC7421 zone)

EMBL: CP000271.PE454

CP000271.PE454       Location/Qualifiers
FT   CDS             534899..535711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2571"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2571"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33422"
FT                   /db_xref="InterPro:IPR012039"
FT                   /db_xref="InterPro:IPR019220"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R67"
FT                   /protein_id="ABE33422.1"
FT                   /translation="MKMKVKTTGWTKASHRFLAVACLAGLQAAPAAYASDIDFAAPLNG
FT                   WRNTSGDSERYTQDVHYPAVSVSTPEGQSRFALIEGQIRNAPKKKGTTVGTLVVDGTPL
FT                   PQRVEEDGKFSRPYAFPAGSNGVELRAPDGSRKRVQFYDAYSGKTQPKLRVLLAWDTDG
FT                   TDLDLHVVSPDGAHTWYGERVAPNGGALDVDVTTGYGPEIYSSAAPLKGTYLVYVNYYG
FT                   SGNSGADMTVAQVTIITNENTPNEKSETIRVPMRKAGELTLVKTFVLP"
     MKMKVKTTGW TKASHRFLAV ACLAGLQAAP AAYASDIDFA APLNGWRNTS GDSERYTQDV        60
     HYPAVSVSTP EGQSRFALIE GQIRNAPKKK GTTVGTLVVD GTPLPQRVEE DGKFSRPYAF       120
     PAGSNGVELR APDGSRKRVQ FYDAYSGKTQ PKLRVLLAWD TDGTDLDLHV VSPDGAHTWY       180
     GERVAPNGGA LDVDVTTGYG PEIYSSAAPL KGTYLVYVNY YGSGNSGADM TVAQVTIITN       240
     ENTPNEKSET IRVPMRKAGE LTLVKTFVLP                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page