(data stored in ACNUC7421 zone)

EMBL: CP000271.PE455

CP000271.PE455       Location/Qualifiers
FT   CDS             complement(536002..536478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2570"
FT                   /product="Conserved hypothetical protein"
FT                   /note="PRC-barrel domain present"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2570"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33423"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R66"
FT                   /protein_id="ABE33423.1"
FT                   /translation="MTTFNPQVPASAGAQGANIVGVGMGDGPGPDVMAASTLDGNKVMS
FT                   SDGEHVGKISDIMLDVRGGRIAYAVLSTGGFLGMGDTLHAIPWSALTLDTDDRCFVLDA
FT                   SADRIKNAPGFDKDNWPLMADTQWGTAVHEYYNRPPYWSATRGAVEERDVDSDL"
     MTTFNPQVPA SAGAQGANIV GVGMGDGPGP DVMAASTLDG NKVMSSDGEH VGKISDIMLD        60
     VRGGRIAYAV LSTGGFLGMG DTLHAIPWSA LTLDTDDRCF VLDASADRIK NAPGFDKDNW       120
     PLMADTQWGT AVHEYYNRPP YWSATRGAVE ERDVDSDL                               158
//

If you have problems or comments...

PBIL Back to PBIL home page