(data stored in ACNUC7421 zone)

EMBL: CP000271.PE456

CP000271.PE456       Location/Qualifiers
FT   CDS             complement(536715..538712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2569"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2569"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33424"
FT                   /db_xref="GOA:Q13R65"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R65"
FT                   /protein_id="ABE33424.1"
FT                   /translation="MNPFDREDSQHETAGYAAKAPSGRTAKGKGAGKAIPVAAELPPQQ
FT                   AEERQRQMRALIQLGKEQGYLTHAQINDHLPDNFAQTAAIDSIVSAFNDMGVQVYEQAP
FT                   DAETLLLNSNAPAVVSDDQADEETEVALSTVDSEFGRTTDPVRMYMREMGATELLTRAG
FT                   EIAIAKRIEDGLHEMVQAIAACPLAISAILASAQQVADGELRIDELVDGLNEDTIAAEE
FT                   DSASAEASAEVDADTDGDEDEDSDDDVGPADSSAADEARLKQLTSDCLEIFAQVGMLSD
FT                   QMNASHTRGDVTSKAYQRAREEIQQHLAKIRFTARTIDRLCGDVQQQVAQVRAIERNIL
FT                   QIVVSKSGMPREKFIESFAGHEADLGWTERAARGASAYGAALERHLPAIQSEQQKLIEI
FT                   EATVSLPLKHLKEINRQMVAAESKMRKAKSEMIEANLRLVISIAKKYVNRGMLFLDLIQ
FT                   EGNIGLMKAVDKFEYRRGWKFSTYATWWVRQAVTRSLADQARTIRVPVHMIETINKLNR
FT                   ISREILQQTGQEAHPSVLAERMELSEEKVRGILKIAKQPVSMETPVGDDGDATLGDMIE
FT                   DSAASSPADAAMQADLRAAIDDALDSLSPREAKVLRMRYGINTKSDHTLEEVGKQFDVT
FT                   RERIRQIESKAMRKLMHPSRADRLKSFLDR"
     MNPFDREDSQ HETAGYAAKA PSGRTAKGKG AGKAIPVAAE LPPQQAEERQ RQMRALIQLG        60
     KEQGYLTHAQ INDHLPDNFA QTAAIDSIVS AFNDMGVQVY EQAPDAETLL LNSNAPAVVS       120
     DDQADEETEV ALSTVDSEFG RTTDPVRMYM REMGATELLT RAGEIAIAKR IEDGLHEMVQ       180
     AIAACPLAIS AILASAQQVA DGELRIDELV DGLNEDTIAA EEDSASAEAS AEVDADTDGD       240
     EDEDSDDDVG PADSSAADEA RLKQLTSDCL EIFAQVGMLS DQMNASHTRG DVTSKAYQRA       300
     REEIQQHLAK IRFTARTIDR LCGDVQQQVA QVRAIERNIL QIVVSKSGMP REKFIESFAG       360
     HEADLGWTER AARGASAYGA ALERHLPAIQ SEQQKLIEIE ATVSLPLKHL KEINRQMVAA       420
     ESKMRKAKSE MIEANLRLVI SIAKKYVNRG MLFLDLIQEG NIGLMKAVDK FEYRRGWKFS       480
     TYATWWVRQA VTRSLADQAR TIRVPVHMIE TINKLNRISR EILQQTGQEA HPSVLAERME       540
     LSEEKVRGIL KIAKQPVSME TPVGDDGDAT LGDMIEDSAA SSPADAAMQA DLRAAIDDAL       600
     DSLSPREAKV LRMRYGINTK SDHTLEEVGK QFDVTRERIR QIESKAMRKL MHPSRADRLK       660
     SFLDR                                                                   665
//

If you have problems or comments...

PBIL Back to PBIL home page