(data stored in ACNUC7421 zone)

EMBL: CP000271.PE457

CP000271.PE457       Location/Qualifiers
FT   CDS             complement(545155..545556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2568"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2568"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33425"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R64"
FT                   /protein_id="ABE33425.1"
FT                   /translation="MLLPIARQTADDLALRVHLALDALRRGAGSMTDAQTLTQVMLLTG
FT                   FLAESGFGSATGEQLSAAERAVSAVFDIGRETGKWRLDEAGFSLFAMIATNYDRQLHSA
FT                   PLWAITDASERLDRFTAGMSYQTPVRKRA"
     MLLPIARQTA DDLALRVHLA LDALRRGAGS MTDAQTLTQV MLLTGFLAES GFGSATGEQL        60
     SAAERAVSAV FDIGRETGKW RLDEAGFSLF AMIATNYDRQ LHSAPLWAIT DASERLDRFT       120
     AGMSYQTPVR KRA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page