(data stored in ACNUC7421 zone)

EMBL: CP000271.PE459

CP000271.PE459       Location/Qualifiers
FT   CDS             547193..548386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2566"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2566"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33427"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R62"
FT                   /protein_id="ABE33427.1"
FT                   /translation="MLKLAALSAVPGTLGSLVARSAFAQAGTLQFACPVPMSGPFAANG
FT                   KYADLGMKLAIEQYGKVLGQPLAYTVLDTEGKPATAVRRVQEIAQQKNARFFAGGILSS
FT                   EALAMGKEVQKAGGIFITTAGADEITGKDCNDATFRWSVPTYGAIEQTVRPLIQTLPKA
FT                   KRWYTITPQYVFGDGLLSAAKAIFKEKGIEHVGNSYHSLNEKEFSGYLTNAVAAKPDVL
FT                   LILNFGSQSSDTLRQAVSFGMKNNCTILMAWASGLEQFESLGADLCEGVYFGAQYWHDI
FT                   DSPLNRDLVKRTNAAFKANPNYSLAGSYICTKILLDGIVKAGNVDPKKVIAALEGMKYD
FT                   GLTGPEEVRKGDHQVLKNYYLLKGKAKNKMKNADDYADIVSSGQSFLPLDKTGCKMV"
     MLKLAALSAV PGTLGSLVAR SAFAQAGTLQ FACPVPMSGP FAANGKYADL GMKLAIEQYG        60
     KVLGQPLAYT VLDTEGKPAT AVRRVQEIAQ QKNARFFAGG ILSSEALAMG KEVQKAGGIF       120
     ITTAGADEIT GKDCNDATFR WSVPTYGAIE QTVRPLIQTL PKAKRWYTIT PQYVFGDGLL       180
     SAAKAIFKEK GIEHVGNSYH SLNEKEFSGY LTNAVAAKPD VLLILNFGSQ SSDTLRQAVS       240
     FGMKNNCTIL MAWASGLEQF ESLGADLCEG VYFGAQYWHD IDSPLNRDLV KRTNAAFKAN       300
     PNYSLAGSYI CTKILLDGIV KAGNVDPKKV IAALEGMKYD GLTGPEEVRK GDHQVLKNYY       360
     LLKGKAKNKM KNADDYADIV SSGQSFLPLD KTGCKMV                                397
//

If you have problems or comments...

PBIL Back to PBIL home page