(data stored in ACNUC7421 zone)

EMBL: CP000271.PE460

CP000271.PE460       Location/Qualifiers
FT   CDS             548485..549345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2565"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2565"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33428"
FT                   /db_xref="GOA:Q13R61"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R61"
FT                   /protein_id="ABE33428.1"
FT                   /translation="MNVYLLQIVNGIGVGMLYFLLAVGLSIVFGLLRFVNFAHGAFYLL
FT                   GAYFCYQAMQWSMSFWTALVVVPIVVGALAWVVEKLILRHVYAQQHEFHILVTVGLALV
FT                   VQECAILIWGPLGDNVAVPDMLNGVVIWGSFVYPKYRLFVIGFTAVLAALLWWVLEGTR
FT                   LGSAVRAGSESTEMVSLLGINVLRVFSLVFALGAATAALAGVLAAPIRGVDPFMGIEAL
FT                   SVAFVVVVVGGMGNFLGALVGGLLVGIVQSVMSTLWPEGARLMIYVAMAAVLLLRPNGL
FT                   LGRAA"
     MNVYLLQIVN GIGVGMLYFL LAVGLSIVFG LLRFVNFAHG AFYLLGAYFC YQAMQWSMSF        60
     WTALVVVPIV VGALAWVVEK LILRHVYAQQ HEFHILVTVG LALVVQECAI LIWGPLGDNV       120
     AVPDMLNGVV IWGSFVYPKY RLFVIGFTAV LAALLWWVLE GTRLGSAVRA GSESTEMVSL       180
     LGINVLRVFS LVFALGAATA ALAGVLAAPI RGVDPFMGIE ALSVAFVVVV VGGMGNFLGA       240
     LVGGLLVGIV QSVMSTLWPE GARLMIYVAM AAVLLLRPNG LLGRAA                      286
//

If you have problems or comments...

PBIL Back to PBIL home page