(data stored in ACNUC7421 zone)

EMBL: CP000271.PE461

CP000271.PE461       Location/Qualifiers
FT   CDS             549342..550409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2564"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2564"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33429"
FT                   /db_xref="GOA:Q13R60"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R60"
FT                   /protein_id="ABE33429.1"
FT                   /translation="MIDTSKPIAQSASSVRAQPGLKHSLHRYRFLLLALLVVCVLPLTL
FT                   RSGSLATEVLVFALAALGCNLLLGYTGLLSFGQGIFFGLGSYCAGLVLTRTALPVPAAL
FT                   FAAAIIGAAAAALVGWFSIRQRGTYFVMLTLAFGQLFYFLAYTTPDLTGGDNGLLDIPR
FT                   PALGLFGKTIVPLTSPWQYYGFVAVLFLVVFWLLMRVSHSVFGRTLLAIRDNEARAAAV
FT                   GYDVKRFKLMAFVISGAVTGLAGALHALMTGIAPLSNIDYHTSEMILVMTVIGGTGNLF
FT                   ASVLGAAFYVLFADWLSTLWPRWLLLLGIVLIAVSLFMQRGLWGLGERIWQSLRRRSST
FT                   DAGNGADNDADKEPI"
     MIDTSKPIAQ SASSVRAQPG LKHSLHRYRF LLLALLVVCV LPLTLRSGSL ATEVLVFALA        60
     ALGCNLLLGY TGLLSFGQGI FFGLGSYCAG LVLTRTALPV PAALFAAAII GAAAAALVGW       120
     FSIRQRGTYF VMLTLAFGQL FYFLAYTTPD LTGGDNGLLD IPRPALGLFG KTIVPLTSPW       180
     QYYGFVAVLF LVVFWLLMRV SHSVFGRTLL AIRDNEARAA AVGYDVKRFK LMAFVISGAV       240
     TGLAGALHAL MTGIAPLSNI DYHTSEMILV MTVIGGTGNL FASVLGAAFY VLFADWLSTL       300
     WPRWLLLLGI VLIAVSLFMQ RGLWGLGERI WQSLRRRSST DAGNGADNDA DKEPI            355
//

If you have problems or comments...

PBIL Back to PBIL home page