(data stored in ACNUC7421 zone)

EMBL: CP000271.PE462

CP000271.PE462       Location/Qualifiers
FT   CDS             550406..551173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2563"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2563"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33430"
FT                   /db_xref="GOA:Q13R59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R59"
FT                   /protein_id="ABE33430.1"
FT                   /translation="MSEAILRASGVVKRYGKFTALADVTLNIMPRTVHSVIGPNGAGKT
FT                   TLFHVLTGTLPITEGKIVFDGHDVTHEPDHKRVRRGVARSFQVTSLFANLSVRENLRLA
FT                   AQGVDAVRALNAWAPPHGALTHSDTVDSVLERLALQRFSEVSAGALSHGQQRRLEVGMA
FT                   LAARPKAIFLDEPTSGMGIDDLDDMKQLIRGLRDDYTVVLIEHNMGIVMDISDTITVMQ
FT                   QGRVLVEGRPDDIRGDERVRSAYLGNMITGGRA"
     MSEAILRASG VVKRYGKFTA LADVTLNIMP RTVHSVIGPN GAGKTTLFHV LTGTLPITEG        60
     KIVFDGHDVT HEPDHKRVRR GVARSFQVTS LFANLSVREN LRLAAQGVDA VRALNAWAPP       120
     HGALTHSDTV DSVLERLALQ RFSEVSAGAL SHGQQRRLEV GMALAARPKA IFLDEPTSGM       180
     GIDDLDDMKQ LIRGLRDDYT VVLIEHNMGI VMDISDTITV MQQGRVLVEG RPDDIRGDER       240
     VRSAYLGNMI TGGRA                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page