(data stored in ACNUC7421 zone)

EMBL: CP000271.PE463

CP000271.PE463       Location/Qualifiers
FT   CDS             551170..551871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2562"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2562"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33431"
FT                   /db_xref="GOA:Q13R58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R58"
FT                   /protein_id="ABE33431.1"
FT                   /translation="MILDVQQIHGFYGKSHILQGVSLQINEGETVTLLGRNGAGKSTTL
FT                   KAIAGVVAPQRGTVTFNGAEIGGLPPHKIASRGVCFVPEHRGIFRLLTVEENLRLGARK
FT                   DSPWQLGDIYRIFPRLQERRTNGGAQLSGGEQQMLAIGRALMNHPRLLMLDEPVEGLAP
FT                   VIVEEIVAQLKLIREAGVAILLVEQNLEVCTQLADRHYIIEQGVIVYSGDNASFSADDS
FT                   IKDRYLGVGVV"
     MILDVQQIHG FYGKSHILQG VSLQINEGET VTLLGRNGAG KSTTLKAIAG VVAPQRGTVT        60
     FNGAEIGGLP PHKIASRGVC FVPEHRGIFR LLTVEENLRL GARKDSPWQL GDIYRIFPRL       120
     QERRTNGGAQ LSGGEQQMLA IGRALMNHPR LLMLDEPVEG LAPVIVEEIV AQLKLIREAG       180
     VAILLVEQNL EVCTQLADRH YIIEQGVIVY SGDNASFSAD DSIKDRYLGV GVV              233
//

If you have problems or comments...

PBIL Back to PBIL home page