(data stored in ACNUC7421 zone)

EMBL: CP000271.PE465

CP000271.PE465       Location/Qualifiers
FT   CDS             553181..554671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2560"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2560"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33433"
FT                   /db_xref="GOA:Q13R56"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R56"
FT                   /protein_id="ABE33433.1"
FT                   /translation="MKILIARMNHETNTFSPVATPLAAFGRNGPSYGEDAFTENKGMQT
FT                   AMAAFIDAAEKEHAEIVTPVSASANPSGPVEAAAYAAICESIVSAAAGCDAVMLDLHGA
FT                   MVAENSNDGEGDLLERVRALLPDAPIAVALDLHGNVTQKMIDNADVIVSFKTYPHVDMY
FT                   ETGAHAARLLFDLIHGKAKPVIAWRQPPLLTHTLRSATAEGAMKRAVDAARAAEADGML
FT                   AVSVLSGFSLADIAAPCISVVVVGNGERAEAEAVAERIARQIWDEREDFVYRSAPLADS
FT                   VAQAATLAVNADKPVLLLDHGDNCMSGGTCDTMDLLEEALKQKLDGIVSGPLCDPQAVA
FT                   ALMAAGVGSTVTVTIGNKIASDALKPRSPLAVTGVVRALTDGEYVISGPTYTGQRAFMG
FT                   RAAVLDTGAVKLVITERTHEPWDLGVFESVGIDPRRARFLLLKSRMYCRPVFVPIAAAL
FT                   VECDSRGVTSSDYGLFAFAHVKRPVYPLDTQTEWAVTN"
     MKILIARMNH ETNTFSPVAT PLAAFGRNGP SYGEDAFTEN KGMQTAMAAF IDAAEKEHAE        60
     IVTPVSASAN PSGPVEAAAY AAICESIVSA AAGCDAVMLD LHGAMVAENS NDGEGDLLER       120
     VRALLPDAPI AVALDLHGNV TQKMIDNADV IVSFKTYPHV DMYETGAHAA RLLFDLIHGK       180
     AKPVIAWRQP PLLTHTLRSA TAEGAMKRAV DAARAAEADG MLAVSVLSGF SLADIAAPCI       240
     SVVVVGNGER AEAEAVAERI ARQIWDERED FVYRSAPLAD SVAQAATLAV NADKPVLLLD       300
     HGDNCMSGGT CDTMDLLEEA LKQKLDGIVS GPLCDPQAVA ALMAAGVGST VTVTIGNKIA       360
     SDALKPRSPL AVTGVVRALT DGEYVISGPT YTGQRAFMGR AAVLDTGAVK LVITERTHEP       420
     WDLGVFESVG IDPRRARFLL LKSRMYCRPV FVPIAAALVE CDSRGVTSSD YGLFAFAHVK       480
     RPVYPLDTQT EWAVTN                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page