(data stored in ACNUC7421 zone)

EMBL: CP000271.PE466

CP000271.PE466       Location/Qualifiers
FT   CDS             555131..556834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2559"
FT                   /product="homodimeric dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2559"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33434"
FT                   /db_xref="GOA:Q13R55"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R55"
FT                   /protein_id="ABE33434.1"
FT                   /translation="MKKLINEVSAVVPDMLDGLAALNPHLSLLQGSTIIVRADAEAAAA
FT                   RGEVALISGGGSGHEPAHGGYVGPGMLSAAVAGEVFTSPSTDAVLDAIRAVAGAAGALL
FT                   IVKNYTGDRFNFGLAAEIARAEGIPTEMVIVADDVALTASGDHAGRRGLAGTVLVHKIA
FT                   GAAAASGRPLAEVAQIARDVAASLGTMGVALTACTVPAAGKPGFELADGEVEWGLGIHG
FT                   EPGVERGALEPAAAVVDKLLEKIVGDLSLQAGERVALLVNNLGGTPSSELNIVAGAALR
FT                   YLAERGIRTERAWAGTFLSALEMAGISLSLLRVDDQRLGWLDAAAQTSAWPALGGRIAR
FT                   TSARPAPAEPDRASGATLSREATLRRVIEAVCACLLKAEPTLTDMDQRVGDGDLGISLS
FT                   RGARAIIQELDGYPAETTPGAVLRNMSATLRRVVGGTSGPLYAVMLLRAALALEQSGGA
FT                   TPKQWAAAFSAGVDGLMALGGAQPGDRTMVDALKPAADALQAALARSDALDAALKAAVD
FT                   AATEGAAQTASMHPRRGRSSYVGERALGHADPGAHAVALWLAAIREALAE"
     MKKLINEVSA VVPDMLDGLA ALNPHLSLLQ GSTIIVRADA EAAAARGEVA LISGGGSGHE        60
     PAHGGYVGPG MLSAAVAGEV FTSPSTDAVL DAIRAVAGAA GALLIVKNYT GDRFNFGLAA       120
     EIARAEGIPT EMVIVADDVA LTASGDHAGR RGLAGTVLVH KIAGAAAASG RPLAEVAQIA       180
     RDVAASLGTM GVALTACTVP AAGKPGFELA DGEVEWGLGI HGEPGVERGA LEPAAAVVDK       240
     LLEKIVGDLS LQAGERVALL VNNLGGTPSS ELNIVAGAAL RYLAERGIRT ERAWAGTFLS       300
     ALEMAGISLS LLRVDDQRLG WLDAAAQTSA WPALGGRIAR TSARPAPAEP DRASGATLSR       360
     EATLRRVIEA VCACLLKAEP TLTDMDQRVG DGDLGISLSR GARAIIQELD GYPAETTPGA       420
     VLRNMSATLR RVVGGTSGPL YAVMLLRAAL ALEQSGGATP KQWAAAFSAG VDGLMALGGA       480
     QPGDRTMVDA LKPAADALQA ALARSDALDA ALKAAVDAAT EGAAQTASMH PRRGRSSYVG       540
     ERALGHADPG AHAVALWLAA IREALAE                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page