(data stored in ACNUC7421 zone)

EMBL: CP000271.PE467

CP000271.PE467       Location/Qualifiers
FT   CDS             complement(556912..557046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2558"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2558"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33435"
FT                   /db_xref="GOA:Q13R54"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R54"
FT                   /protein_id="ABE33435.1"
FT                   /translation="MKRIAAFSLTSWSAAGLLYFGQHSVALIVVSGVVALAGFDLLRP"
     MKRIAAFSLT SWSAAGLLYF GQHSVALIVV SGVVALAGFD LLRP                         44
//

If you have problems or comments...

PBIL Back to PBIL home page