(data stored in ACNUC7421 zone)

EMBL: CP000271.PE468

CP000271.PE468       Location/Qualifiers
FT   CDS             complement(557050..558105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2557"
FT                   /product="conserved hypothetical membrane protein,
FT                   YraQ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2557"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33436"
FT                   /db_xref="GOA:Q13R53"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R53"
FT                   /protein_id="ABE33436.1"
FT                   /translation="MQSTLRQPRVALGWIVFLLIAVVGLFYVKWFPYYNRAFVAASQHS
FT                   IGKSILMGTSASAPAASWQAAIDYALAYGKAIWQAMVLGLLLGSAVQALIPPQWVARAL
FT                   GRSDFSSVVKGGLMSLPGMMCTCCAAPVVAGLRARQAAPGAAIAFWLGNTALNPATLIF
FT                   MGFVLGWQWMGLRLALGIVMVFGLGYLVNRMVTPKEAEASREAMAQLITSDVPGTAFTR
FT                   WVKILGTMTLRLIPEYIVLVLILGAARTWLFPHVGPDIDNSLLWIVALSIAGTLFVIPT
FT                   AGEVPIIQAMLSFGMAAGPAGALLMTLPLISVPSMAMLARSFPRRVLTVVALAVVVCGV
FT                   VSGLLAVALGF"
     MQSTLRQPRV ALGWIVFLLI AVVGLFYVKW FPYYNRAFVA ASQHSIGKSI LMGTSASAPA        60
     ASWQAAIDYA LAYGKAIWQA MVLGLLLGSA VQALIPPQWV ARALGRSDFS SVVKGGLMSL       120
     PGMMCTCCAA PVVAGLRARQ AAPGAAIAFW LGNTALNPAT LIFMGFVLGW QWMGLRLALG       180
     IVMVFGLGYL VNRMVTPKEA EASREAMAQL ITSDVPGTAF TRWVKILGTM TLRLIPEYIV       240
     LVLILGAART WLFPHVGPDI DNSLLWIVAL SIAGTLFVIP TAGEVPIIQA MLSFGMAAGP       300
     AGALLMTLPL ISVPSMAMLA RSFPRRVLTV VALAVVVCGV VSGLLAVALG F                351
//

If you have problems or comments...

PBIL Back to PBIL home page