(data stored in ACNUC7421 zone)

EMBL: CP000271.PE469

CP000271.PE469       Location/Qualifiers
FT   CDS             complement(558130..559197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2556"
FT                   /product="Putative ATP /GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2556"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33437"
FT                   /db_xref="GOA:Q13R52"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R52"
FT                   /protein_id="ABE33437.1"
FT                   /translation="MKNLLVSLEKAGDFDEIIDVRTPLEFAEDHIPGALNAPVLSNEER
FT                   VLVGTTYKQVSPFEATRIGAALVARNIAHHLETTFADRPRNWRPLIYCWRGGKRSGSVT
FT                   TLFNMIGWQARQLEGGYKTYRRATLDTLDSLPATFSYIALVGPTGSGKTRLLTALNAAG
FT                   AQTLDLEALASHRGSLLGAWAGVPQPSQKRFDTLLVTALRTLDAARPVFVEAESRRIGS
FT                   VALPLALLDTFHRGRCVEVLSSREDRAAFLLHDYAHLFDDPQSLKAQLQRLIGLHSRER
FT                   VTGWQRLVDDNRRAELARELIERHYDPAYARSSHEHFVQLPHALQFNFRPNDADAVDQA
FT                   SALLAQVEGSALAVI"
     MKNLLVSLEK AGDFDEIIDV RTPLEFAEDH IPGALNAPVL SNEERVLVGT TYKQVSPFEA        60
     TRIGAALVAR NIAHHLETTF ADRPRNWRPL IYCWRGGKRS GSVTTLFNMI GWQARQLEGG       120
     YKTYRRATLD TLDSLPATFS YIALVGPTGS GKTRLLTALN AAGAQTLDLE ALASHRGSLL       180
     GAWAGVPQPS QKRFDTLLVT ALRTLDAARP VFVEAESRRI GSVALPLALL DTFHRGRCVE       240
     VLSSREDRAA FLLHDYAHLF DDPQSLKAQL QRLIGLHSRE RVTGWQRLVD DNRRAELARE       300
     LIERHYDPAY ARSSHEHFVQ LPHALQFNFR PNDADAVDQA SALLAQVEGS ALAVI            355
//

If you have problems or comments...

PBIL Back to PBIL home page