(data stored in ACNUC7421 zone)

EMBL: CP000271.PE47

CP000271.PE47        Location/Qualifiers
FT   CDS             complement(52853..54253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2980"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2980"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33015"
FT                   /db_xref="GOA:Q13SC4"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC4"
FT                   /protein_id="ABE33015.1"
FT                   /translation="MSFVIVLAALAFLMFAAYRGYSVILFAPVAALGAVLLTDPAAVAP
FT                   VFTGIFMEKMVGFVKLYFPVFLLGAVFGKVIELSGFSESIVAAAIRYIGRSRANAVIVA
FT                   VCALLTYGGVSLFVVVFAVYPFAAELYRQSNIPKRLMPGAIALGAFSFTMDSLPGTPQI
FT                   QNIIPTTFFKTTSWAAPALGVIGSLFIIVVGLTYLEWRRRSAMATGEGYGTNLVNEPER
FT                   VESKQLPHPLLAVAPLVLVGVANFLLTRWIPNWYGASYTVAPDILPGIHAPVTTTIKAV
FT                   VAIWAVEGALLLGIVMVVITAFNRVRERFAIGTKAAVAGALLASLNTASEYGFGGVIAA
FT                   LPGFLVVSDALKSIPNPLVNAAVSVSSLAGITGSASGGMSIALAAMSDTFIKGAEAAHI
FT                   PMEVLHRVVAMASGGMDTLPHNGAVITLLAVTGLTHRQSYRDIFAVTVIKTMAVFFVIA
FT                   VYYATGLV"
     MSFVIVLAAL AFLMFAAYRG YSVILFAPVA ALGAVLLTDP AAVAPVFTGI FMEKMVGFVK        60
     LYFPVFLLGA VFGKVIELSG FSESIVAAAI RYIGRSRANA VIVAVCALLT YGGVSLFVVV       120
     FAVYPFAAEL YRQSNIPKRL MPGAIALGAF SFTMDSLPGT PQIQNIIPTT FFKTTSWAAP       180
     ALGVIGSLFI IVVGLTYLEW RRRSAMATGE GYGTNLVNEP ERVESKQLPH PLLAVAPLVL       240
     VGVANFLLTR WIPNWYGASY TVAPDILPGI HAPVTTTIKA VVAIWAVEGA LLLGIVMVVI       300
     TAFNRVRERF AIGTKAAVAG ALLASLNTAS EYGFGGVIAA LPGFLVVSDA LKSIPNPLVN       360
     AAVSVSSLAG ITGSASGGMS IALAAMSDTF IKGAEAAHIP MEVLHRVVAM ASGGMDTLPH       420
     NGAVITLLAV TGLTHRQSYR DIFAVTVIKT MAVFFVIAVY YATGLV                      466
//

If you have problems or comments...

PBIL Back to PBIL home page