(data stored in ACNUC7421 zone)

EMBL: CP000271.PE471

CP000271.PE471       Location/Qualifiers
FT   CDS             561087..561731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2554"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   catalytic subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2554"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33439"
FT                   /db_xref="GOA:Q13R50"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R50"
FT                   /protein_id="ABE33439.1"
FT                   /translation="MPPSIIMISTPKKSRGHSMPHMSRRQFLKVSATTLAGSSLALMGF
FT                   SPTPALAEVRQYKLSRTTETRNTCPYCSVGCGILMYGLGDNAKNAKSSIIHIEGDPDHP
FT                   VNRGTLCPKGASLIDFIHSPSRLKYPEYRAAGSNEWKRISWEDALDRIAKLMKEDRDAN
FT                   FVETTEDGKKVNRWLTTGMLAASAGSNEVGYLTHKAVRSLGMLAFDNQARV"
     MPPSIIMIST PKKSRGHSMP HMSRRQFLKV SATTLAGSSL ALMGFSPTPA LAEVRQYKLS        60
     RTTETRNTCP YCSVGCGILM YGLGDNAKNA KSSIIHIEGD PDHPVNRGTL CPKGASLIDF       120
     IHSPSRLKYP EYRAAGSNEW KRISWEDALD RIAKLMKEDR DANFVETTED GKKVNRWLTT       180
     GMLAASAGSN EVGYLTHKAV RSLGMLAFDN QARV                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page