(data stored in ACNUC7421 zone)

EMBL: CP000271.PE472

CP000271.PE472       Location/Qualifiers
FT   CDS             561744..564209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2553"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   catalytic subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2553"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33440"
FT                   /db_xref="GOA:Q13R49"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R49"
FT                   /protein_id="ABE33440.1"
FT                   /translation="MAGLAPTFGRGAMTNHWVDIKNADVILVMGGNAAEAHPCGFKWVT
FT                   EAKAHRKARLIVVDPRFTRTASVADYYAQIRTGSDIVFLGGVINYLLTNDKIQHEYVKN
FT                   YTDMPFIVREDFSFTDGLYSGYNADKRKYDQSSWDYERGDDGFAKVDPTLQHPRCVYQL
FT                   MKQHYSRYTPEQVEKACGTPKEKFLKVCEMLASTAVPGRAGTVLYALGWTHHSIGAQII
FT                   RTGAMVQLLLGNIGIAGGGMNALRGHSNIQGLTDLGLMSNLLPGYMTLPLEAEQDFDAF
FT                   IKKRASQPLRPNQLSYWRNYRAFHVSFMKSWWGDNATAENNFGFDYLPKLDKSYDMLQV
FT                   FELMNQGKMTGYIAQGFNPLAAAPNKAKIGAGLAKLKWLVVMDPLATETSEFWKNFGEF
FT                   NDVDPASIQTEVFRLPTTCFAEERGSLVSSSRVLQWHWQGADGPGESRSDLEIMSGLWL
FT                   RIREAYRKNGGKYPDPILNMSWPYANPESPTPEEIAMEFNGKALADVTDATDKTKVLAK
FT                   KGEQLASFAQLRDDGSTASGCWIFCGSWTQAGNQMGRRDNSDPTGIGNTLNWAWAWPAN
FT                   RRILYNRASCDVSGKPFDPTRKLIAWNGKAWAGADIPDFKVDEPPENGMNPFIMNPEGV
FT                   ARFFSRDGLVEGPFPEHYEPFETPIGYNPLHPDNKLVVSSPAARVFPDDRAAFGTHENF
FT                   PHTATTYRLTEHFHYWTKHARLNAIVQPQQFVEIGEDLAKEVGVVAGDRVKVSSNRGHI
FT                   IAVALVTKRIKPLMIEGKKVQTVGLPLHWGFKGLTKPGYLVNTLTPSVGDGNSQTPEFK
FT                   SFLVKVEKA"
     MAGLAPTFGR GAMTNHWVDI KNADVILVMG GNAAEAHPCG FKWVTEAKAH RKARLIVVDP        60
     RFTRTASVAD YYAQIRTGSD IVFLGGVINY LLTNDKIQHE YVKNYTDMPF IVREDFSFTD       120
     GLYSGYNADK RKYDQSSWDY ERGDDGFAKV DPTLQHPRCV YQLMKQHYSR YTPEQVEKAC       180
     GTPKEKFLKV CEMLASTAVP GRAGTVLYAL GWTHHSIGAQ IIRTGAMVQL LLGNIGIAGG       240
     GMNALRGHSN IQGLTDLGLM SNLLPGYMTL PLEAEQDFDA FIKKRASQPL RPNQLSYWRN       300
     YRAFHVSFMK SWWGDNATAE NNFGFDYLPK LDKSYDMLQV FELMNQGKMT GYIAQGFNPL       360
     AAAPNKAKIG AGLAKLKWLV VMDPLATETS EFWKNFGEFN DVDPASIQTE VFRLPTTCFA       420
     EERGSLVSSS RVLQWHWQGA DGPGESRSDL EIMSGLWLRI REAYRKNGGK YPDPILNMSW       480
     PYANPESPTP EEIAMEFNGK ALADVTDATD KTKVLAKKGE QLASFAQLRD DGSTASGCWI       540
     FCGSWTQAGN QMGRRDNSDP TGIGNTLNWA WAWPANRRIL YNRASCDVSG KPFDPTRKLI       600
     AWNGKAWAGA DIPDFKVDEP PENGMNPFIM NPEGVARFFS RDGLVEGPFP EHYEPFETPI       660
     GYNPLHPDNK LVVSSPAARV FPDDRAAFGT HENFPHTATT YRLTEHFHYW TKHARLNAIV       720
     QPQQFVEIGE DLAKEVGVVA GDRVKVSSNR GHIIAVALVT KRIKPLMIEG KKVQTVGLPL       780
     HWGFKGLTKP GYLVNTLTPS VGDGNSQTPE FKSFLVKVEK A                           821
//

If you have problems or comments...

PBIL Back to PBIL home page