(data stored in ACNUC7421 zone)

EMBL: CP000271.PE473

CP000271.PE473       Location/Qualifiers
FT   CDS             564219..565151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2552"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   iron-sulfur subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2552"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33441"
FT                   /db_xref="GOA:Q13R48"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R48"
FT                   /protein_id="ABE33441.1"
FT                   /translation="MALQSLDIKRLSATTLPEPQVREPVTGTVAKLIDVSKCIGCKACQ
FT                   TACMEWNDLRDEIGTTTGIYDNPRDLSEHSWTVMRFSEYENTEGDLEWLIRKDGCMHCE
FT                   DPGCLKACPSPGAIVQYTNGIVDFHEENCIGCGYCVTGCPFNVPRISKKDNRAYKCTLC
FT                   SDRVAVGQEPACVKTCPTGAIMFGTKEDMKQQAADRVEDLKERGFQNAGLYDPAGVGGT
FT                   HVMYVLHHADKANLYHGLPQNPKISAMVGLWKGLAKPLALAGIAFAAVAGFFHYTRVGP
FT                   NEVSEAEEAEAQHEADEARRSREASNEAP"
     MALQSLDIKR LSATTLPEPQ VREPVTGTVA KLIDVSKCIG CKACQTACME WNDLRDEIGT        60
     TTGIYDNPRD LSEHSWTVMR FSEYENTEGD LEWLIRKDGC MHCEDPGCLK ACPSPGAIVQ       120
     YTNGIVDFHE ENCIGCGYCV TGCPFNVPRI SKKDNRAYKC TLCSDRVAVG QEPACVKTCP       180
     TGAIMFGTKE DMKQQAADRV EDLKERGFQN AGLYDPAGVG GTHVMYVLHH ADKANLYHGL       240
     PQNPKISAMV GLWKGLAKPL ALAGIAFAAV AGFFHYTRVG PNEVSEAEEA EAQHEADEAR       300
     RSREASNEAP                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page