(data stored in ACNUC7421 zone)

EMBL: CP000271.PE474

CP000271.PE474       Location/Qualifiers
FT   CDS             565138..565794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2551"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   cytochrome b subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2551"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33442"
FT                   /db_xref="GOA:Q13R47"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R47"
FT                   /protein_id="ABE33442.1"
FT                   /translation="MKHPEHTGLKDVKGNSLIVRYTPNERTNHWITAITFVLLALSGLA
FT                   MFHPAMSWLYAIFGGGQWTRILHPFVGCVMFLSFLILALRFWHHNYLNKADIQWMKQID
FT                   DVLNNREEKLPAIGKYNAGQKLLFFTMVICLLLLLASGIVIWRRYFSFYFPIGIIRLAA
FT                   LVHAAAAFVLIVGIVVHIYAALWIKGSIGAMTRGTVTYGWARKHHPNWFKEIIGK"
     MKHPEHTGLK DVKGNSLIVR YTPNERTNHW ITAITFVLLA LSGLAMFHPA MSWLYAIFGG        60
     GQWTRILHPF VGCVMFLSFL ILALRFWHHN YLNKADIQWM KQIDDVLNNR EEKLPAIGKY       120
     NAGQKLLFFT MVICLLLLLA SGIVIWRRYF SFYFPIGIIR LAALVHAAAA FVLIVGIVVH       180
     IYAALWIKGS IGAMTRGTVT YGWARKHHPN WFKEIIGK                               218
//

If you have problems or comments...

PBIL Back to PBIL home page