(data stored in ACNUC7421 zone)

EMBL: CP000271.PE475

CP000271.PE475       Location/Qualifiers
FT   CDS             565904..566899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2550"
FT                   /product="Formate dehydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2550"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33443"
FT                   /db_xref="GOA:Q13R46"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R46"
FT                   /protein_id="ABE33443.1"
FT                   /translation="MVQRILEAGDIESLDHSAIPRIRTPERLAVFSARAARLRQLAALN
FT                   NPIAGYLRLMAVLADAQQAVMAGFKARPPSPELIASAQQHSMPLIPALSGVRDPAWRDV
FT                   LRQLLDKVAAAGPLTPPLEALIDHLRTLDTAALEFQSDAIFAQRFEEVDPASAPFIVAA
FT                   LQVVWTDLAADIDKREVPYIETLGLCPVCGSHPVASIVRVGGAYDNYRYLQCGLCSTEW
FT                   HMVRAKCSNCDSTKGIAYHTVGSPDADEATRETESKNAALKAESCDECHTYRKIGIQSK
FT                   DYDFEPFADDLASLTLDLLMGAEGYRRASPHPWLWPEQAAGADELSGESD"
     MVQRILEAGD IESLDHSAIP RIRTPERLAV FSARAARLRQ LAALNNPIAG YLRLMAVLAD        60
     AQQAVMAGFK ARPPSPELIA SAQQHSMPLI PALSGVRDPA WRDVLRQLLD KVAAAGPLTP       120
     PLEALIDHLR TLDTAALEFQ SDAIFAQRFE EVDPASAPFI VAALQVVWTD LAADIDKREV       180
     PYIETLGLCP VCGSHPVASI VRVGGAYDNY RYLQCGLCST EWHMVRAKCS NCDSTKGIAY       240
     HTVGSPDADE ATRETESKNA ALKAESCDEC HTYRKIGIQS KDYDFEPFAD DLASLTLDLL       300
     MGAEGYRRAS PHPWLWPEQA AGADELSGES D                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page