(data stored in ACNUC7421 zone)

EMBL: CP000271.PE480

CP000271.PE480       Location/Qualifiers
FT   CDS             574127..575239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2544"
FT                   /product="ABC spermidine/putrescine transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2544"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33448"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R41"
FT                   /protein_id="ABE33448.1"
FT                   /translation="MKAPLSHRCNKAVNDADADAATQADSSSRSRRAFLQRAGALAGAA
FT                   ILGAPAIVRAQSKSISVTCWGGAYEAAVRAAFAEPFTKETGIAVNLVNSADLARMKVQV
FT                   ESKNVSWDVFDSIGPQIVAGSRGGMWEKLDPAIVRTDGLITRTGADFVGTYSYAGGIGF
FT                   DPKRAGKHPLTYAEFWDVTAFPGRRGLRPRVSENLEMALLADGVAPDKLYPLDIERAFK
FT                   AMDRIKPAVRKWIETTPETVSLIASNELDFTYTYLSRVLPAQRAGTSIAMSMKQTLNSL
FT                   EYLAVPKYGKNTQAAMKYVAFCLRPDRQAAFCEKVEFAPNVAQALPLVSATAKARMPDM
FT                   HDPNSVIINDTWWGDHYDALQNRFTTWMLT"
     MKAPLSHRCN KAVNDADADA ATQADSSSRS RRAFLQRAGA LAGAAILGAP AIVRAQSKSI        60
     SVTCWGGAYE AAVRAAFAEP FTKETGIAVN LVNSADLARM KVQVESKNVS WDVFDSIGPQ       120
     IVAGSRGGMW EKLDPAIVRT DGLITRTGAD FVGTYSYAGG IGFDPKRAGK HPLTYAEFWD       180
     VTAFPGRRGL RPRVSENLEM ALLADGVAPD KLYPLDIERA FKAMDRIKPA VRKWIETTPE       240
     TVSLIASNEL DFTYTYLSRV LPAQRAGTSI AMSMKQTLNS LEYLAVPKYG KNTQAAMKYV       300
     AFCLRPDRQA AFCEKVEFAP NVAQALPLVS ATAKARMPDM HDPNSVIIND TWWGDHYDAL       360
     QNRFTTWMLT                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page